Sorry, My Interstellar Fleet Only Recruits Women
Chapter 286: Three prisoners
- Chapter 1010: The Secret of the Existence of the Mechanical Race
- Chapter 1009: Ancient Empire
- Chapter 1008: Big changes are going to happen
- Chapter 1007: Counterattack Plan
- Chapter 1006: The Devil’s Fury
- Chapter 1005: Xiaolong Guard Fleet!
- Chapter 1004: Terror of the Scarlet Death
- Chapter 1003: Four T5 models in one year?
- Chapter 1002: The King of the North
- Chapter 1001: A plan that kills two birds with one stone
- Chapter 1000: Ge Hui’s Oracle
- Chapter 999: The story of the doctor
- Chapter 998: Doctor? Mechanical Prophet
- Chapter 997: Confrontation on the Planet
- Chapter 996: Holy Land of the Mechanicus
- Chapter 995: King of the Hill!
- Chapter 994: The strongest meat shield
- Chapter 993: There are many secrets hidden here
- Chapter 992: A Trap?
- Chapter 991: Mechanicus
- Chapter 990: Pick up the biggest one
- Chapter 989: Holy Land of the Prophet
- Chapter 988: T5 sequence of the mechanical family
- Chapter 987: Secret Starship Factory
- Chapter 986: Whistleblower Military Operation
- Chapter 985: Negotiate terms
- Chapter 984: Machines and Demons
- Chapter 983: There can only be one winner!
- Chapter 982: Special starship weapons technology
- Chapter 981: Commander’s Gift
- Chapter 980: 100 trillion orders
- Chapter 979: The T5 really can’t be sold.
- Chapter 978: Military purchase orders worth hundreds of trillions of star coins
- Chapter 977: Quote for the Xiaolong starship
- Chapter 976: The glorious victory of the Holy Dragon Angel Legion!
- Chapter 975: Make a big splash!
- Chapter 974: Tilia’s saturation fire attack
- Chapter 973: Reinforcements? Just 10,000 ships?
- Chapter 972: Holy Dragon Angel Legion
- Chapter 971: Tilia’s Preparation
- Chapter 970: Anne’s Boudoir
- Chapter 969: United front!
- Chapter 968: The Demonic Attack
- Chapter 967: The Devil’s Castle
- Chapter 966: Three new ships
- Chapter 965: The Swarm Mission Completed
- Chapter 964: Can’t this universe be a little more stable?
- Chapter 963: Can you beat me?
- Chapter 962: Internal strife among the mechanical race
- Chapter 961: To our heroes
- Chapter 960: The insect disaster is over
- Chapter 959: Others are watching
- Chapter 958: The Leviathan Shaman-class hive carrier has fallen!
- Chapter 957: We did it!
- Chapter 956: The only chance!
- Chapter 955: A raid of fifteen starships!
- Chapter 954: The last move
- Chapter 953: You only have one hour!
- Chapter 952: The horn of counterattack!
- Chapter 951: Making a feint to the east and attacking in the west
- Chapter 950: Charlotte Assault
- Chapter 949: Combat Operations
- Chapter 948: Leader of the Swarm
- Chapter 947: Your AI is pretty average.
- Chapter 946: Charlotte’s Bug Slayer
- Chapter 945: Pluto kills the Leviathan King-class hive mothership!
- Chapter 944: Charlotte’s Battle Plan
- Chapter 943: If there is no road, make one.
- Chapter 942: Changes in the No. 4 Main Camp
- Chapter 941: If you keep wasting time, you will die slowly.
- Chapter 940: The stalemate of the battle!
- Chapter 939: Swarm of Insects
- Chapter 938: This battle! I will not retreat until the Zerg are destroyed!
- Chapter 937: Swarm Frenzy: On
- Chapter 936: War is coming!
- Chapter 935: Last three hours!
- Chapter 934: Give the old man my entire great-grandchild
- Chapter 933: Mr. Chu’s little secret
- Chapter 932: Clean up every bug
- Chapter 931: Let’s deal with these little troubles first.
- Chapter 930: Assemble! Two million starships!
- Chapter 929: Emergency war mobilization of the three empires
- Chapter 928: Extreme pull
- Chapter 927: Swarm frenzy?
- Chapter 926: Opened quarterly tasks
- Chapter 925: The hunted demon
- Chapter 924: Want to leave? Have you asked me?
- Chapter 923: Roar of the Cannon
- Chapter 922: Holy Redeemer
- Chapter 921: One versus Three
- Chapter 920: Su Lan’s aircraft carrier star fleet
- Chapter 919: T5 Fire Kylin Class Heavy Aircraft Carrier Starship Debut
- Chapter 918: This artificial intelligence has more than 100 million words
- Chapter 917: T5 Dragon Emperor Interstellar Command Ship - In Position
- Chapter 916: The demon army is coming
- Chapter 915: Maybe it’s just a performance.
- Chapter 914: The Storm Is Coming
- Chapter 913: The first collaboration with the Mechanoids
- Chapter 912: You don’t want to lose us as an ally, do you?
- Chapter 911: Alliance with the Angels
- Chapter 910: Second meeting
- Chapter 910: Second meeting
- Chapter 909: A little surprise prepared by Zhao Chen
- Chapter 908: Inspection
- Chapter 907: The military procurement order...is it really completed?
- Chapter 906: Interstellar Industrial Base Completed!
- Chapter 905: The crisis is here again!
- Chapter 904: Big money sponsor!
- Chapter 903: The first wave of military purchase orders with the Angels
- Chapter 902: The Three Angel Kings
- Chapter 901: The Holy Mountain among the Stars
- Chapter 900: The Angelic System
- Chapter 899: Angelic Civilization
- Chapter 898: The Secret of the Mechanoids
- Chapter 897: It better not be you who did this!
- Chapter 896: Imprisonment? Imprisonment? Or dissection of my brain?
- Chapter 895: The supreme ruler of the mechanical race
- Chapter 894: Pluto lost contact
- Chapter 893: Sudden crisis
- Chapter 892: Befriend or destroy
- Chapter 891: Prepare to set off to the Angel Tribe
- Chapter 890: T5 Holy Redeemer and T5 Fire Kirin
- Chapter 889: Technology of T5 Dragon King
- Chapter 888: One step slow, every step slow!
- Chapter 887: The first habitable planet
- Chapter 886: Commander: The Temptation of Work
- Chapter 885: T5 technology is explosive!
- Chapter 884: It’s New Year’s Eve again
- Chapter 883: The decision of the Red Demon Marshal
- Chapter 882: Resurrection from the dead
- Chapter 881: Sad celebration party
- Chapter 880: Build a military base
- Chapter 879: Lilith’s future plans
- Chapter 878: How about you sit down?
- Chapter 877: Hard to guard against
- Chapter 876: T5 Super Soldier Potion
- Chapter 875: Interstellar command ship!
- Chapter 874: System Gift Pack
- Chapter 873: The Desperate Demon Fleet
- Chapter 872: The Hunted Flagship: T5 Terrorblade
- Chapter 871: Hunting of the Lightning Ghost
- Chapter 870: How many T5s do they have!
- Chapter 869: Chaos Knight’s First Battle
- Chapter 868: Let the cub go, hit the calf
- Chapter 867: Demon’s Terrorblade
- Chapter 866: Pain and happiness
- Chapter 865: This will be their cemetery.
- Chapter 864: The end is also the beginning!
- Chapter 863: We can’t let them pass!
- Chapter 862: Build a waterway!
- Chapter 861: Chi Tong and Su Lan’s cooperation
- Chapter 860: You only have four hours
- Chapter 859: The situation suddenly changed!
- Chapter 858: Cautious Red Demon Legion Commander
- Chapter 857: The demon crisis strikes again
- Chapter 856: I choose to stay
- Chapter 855: Rapid service
- Chapter 854: Final sprint stage
- Chapter 853: The Great Infrastructure Era of the Star Empire
- Chapter 852: Uncrowned King
- Chapter 851: Red Demon Marshal
- Chapter 850: Put your hope on a human race?
- Chapter 849: Angel’s Request
- Chapter 848: Contact Angel Tribe
- Chapter 847: Saint Family? Sorry, I have destroyed them.
- Chapter 846: Saints’ diplomatic partners
- Chapter 845: This is a misunderstanding
- Chapter 844: Holy Angel Queen
- Chapter 843: My daughter is going to be the empress?
- Chapter 842: Ancient etiquette
- Chapter 841: The Fallen Imperial Senate
- Chapter 840: Left hand lives, right hand dies
- Chapter 839: Santa Canna’s Plan
- Chapter 838: Legendary Starship
- Chapter 837: The End of the Saints
- Chapter 836: The ugliness of the catastrophe
- Chapter 835: This empire can only have one voice
- Chapter 834: I’d give it everything for this
- Chapter 833: The third generation of Xiaolong generals are activated
- Chapter 832: Release T3 permissions
- Chapter 831: Warhammer Star Federation Kingdom: Announced
- Chapter 830: How about we go on vacation?
- Chapter 829: Anne’s Holiday Plans
- Chapter 828: Demon Starship Interior
- Chapter 827: Anne’s Vacation
- Chapter 826: Permissions enabled
- Chapter 825: We need more starships
- Chapter 824: The gears of fate begin to turn
- Chapter 823: The Dragon Tribe is willing to listen to the arrangements
- Chapter 822: What’s the use of building more starships like this?
- Chapter 821: Sisters united
- Chapter 820: The demon fleet was defeated
- Chapter 819: Xiaolong Legion PK Demon Fleet
- Chapter 818: Interstellar air combat
- Chapter 817: The Despair and Collapse of the Demon Commander
- Chapter 816: Will he be out of firepower?
- Chapter 815: It’s really a T5!
- Chapter 814: Legendary warships, shining debut
- Chapter 813: The target airspace has been cleared, and space jump has started
- Chapter 812: A Flame of Hope
- Chapter 811: Waiting for our support to arrive
- Chapter 810: The battle situation changed suddenly!
- Chapter 809: How dare you show your fangs to mere prey?
- Chapter 808: Emergency
- Chapter 807: The Fate of Saint Canna
- Chapter 806: My friend Santa Cana
- Chapter 805: The mess of the empire
- Chapter 804: The final T5 mall mission
- Chapter 803: My tribe’s Nizi is so moist
- Chapter 802: The enemy of my enemy is my friend
- Chapter 801: Five Demon T4 Star Wars
- Chapter 800: Demon Fleet Information
- Chapter 799: Establish a new alliance and fight against the demons together!
- Chapter 798: Bro? Did you get the wrong script?
- Chapter 797: A blatant threat
- Chapter 796: T5 level mission rewards!
- Chapter 795: Final annual mission
- Chapter 794: The situation of the dragon tribe
- Chapter 793: Two empires together
- Chapter 792: The dragon fleet was completely wiped out?
- Chapter 791: Is the Dragon Emperor gone?
- Chapter 790: Two major events occurred!
- Chapter 789: The two confused dragon princesses
- Chapter 788: The T5 Starship that breaks the balance
- Chapter 787: Kill all enemies with one sword
- Chapter 786: Exceeding the critical value? What kind of monster is that!
- Chapter 785: Second attack mode: Pluto’s Sword
- Chapter 784: The first battle of the T5 Pluto-class star dreadnought was a success
- Chapter 783: The Lost Holy Wings
- Chapter 782: Pluto Realm: Start
- Chapter 781: The beast from deep space
- Chapter 780: Holy Wings Legion
- Chapter 779: He will come as a king
- Chapter 778: Each with his own agenda
- Chapter 777: Blanche and Leona’s Disagreement
- Chapter 776: Warhammer United Civil War begins
- Chapter 775: Millions of interstellar battleships VS Xiaolong Army
- Chapter 774: War begins
- Chapter 773: Pressure at the conference table
- Chapter 772: The first T5 was completed
- Chapter 771: Find the area of Leona’s shadow
- Chapter 770: Zhao Chen VS Dragon Princess
- Chapter 769: The grumpy dragon girl Leona
- Chapter 768: The surrender of the two clan leaders
- Chapter 767: Leona’s Request
- Chapter 766: Winning over neutral tribes
- Chapter 765: Black Fox’s Reward
- Chapter 764: This piece of trash is worth 5 billion?
- Chapter 763: Watch Your Attitude
- Chapter 762: Blood of the Black Tiger Mountain
- Chapter 761: ransom?
- Chapter 760: Warhammer and Glory collaboration
- Chapter 759: Disobedient chess pieces should not appear on the chessboard
- Chapter 758: The story of the fox tribe
- Chapter 757: The Fate of the Fox Tribe
- Chapter 756: Fox Queen
- Chapter 755: Recapture the Black Tiger Star Region
- Chapter 754: Charlotte’s unyielding spirit
- Chapter 753: It’s okay, I’m here
- Chapter 752: Day of Judgment
- Chapter 751: I am willing to bear the consequences of any decision she makes.
- Chapter 750: Massacre of the Black Tiger King’s Legion
- Chapter 749: Bloody White Tiger Emblem
- Chapter 748: The final scene of Black Tiger Prime
- Chapter 747: The Blood Debt of the Black Tiger King Naval Port
- Chapter 746: Lightning Attack Black Tiger King Military Port
- Chapter 745: Target: Black Tiger Star Region
- Chapter 744: What exactly is in the Xiaolong galaxy?
- Chapter 743: Guide to Avina
- Chapter 742: T5 level technology!
- Chapter 741: Spider Queen Elise’s Shock
- Chapter 740: Panic Anne
- Chapter 739: Super Worker: Spider Queen Elise
- Chapter 738: Lilith and Charlotte’s ’common hatred’
- Chapter 737: Visit the Xiaolong system
- Chapter 736: The Spider Queen and the Harpy
- Chapter 735: Dragon Princess
- Chapter 734: This war is too costly.
- Chapter 733: Beast Alliance
- Chapter 732: I’ll treat you to hot pot
- Chapter 731: Slaughtering chickens and pigs
- Chapter 730: The Hunt After the Fireworks Show
- Chapter 729: The first battle of the Warhammer of the Xiaolong Legion
- Chapter 728: Xiaolong Legion VS Dragon Fleet
- Chapter 727: No tears until the coffin
- Chapter 726: The betrayal of the peacemakers
- Chapter 725: The Revolutionary Army’s Parliamentary Divisions
- Chapter 724: The Fifth Army’s Commander
- Chapter 723: The next strategic goal: Warhammer!
- Chapter 722: Internal Troubles of the Revolutionary Army
- Chapter 721: Let them stare into the abyss
- Chapter 720: Charlotte’s Permanent Meal Card
- Chapter 719: Super military procurement order
- Chapter 718: The Empress’s Reward
- Chapter 717: The Strongest Man in the Empire
- Chapter 716: A father is honored by his daughter
- Chapter 715: Li Wei’s Story
- Chapter 714: My brothers are gone...
- Chapter 713: Two modes of T4 Thunder Warrior
- Chapter 712: The elder sister’s obsession
- Chapter 711: The Man Behind the Star Empire
- Chapter 710: The largest military enterprise in the future of the Xingyao Empire
- Chapter 709: Qin Xiaotian and Dr.
- Chapter 708: The situation has changed dramatically
- Chapter 707: What does Annie, that little brat, know?
- Chapter 706: Lilith shows up halfway
- Chapter 705: Am I the only one who can see this?
- Chapter 704: Terror is coming
- Chapter 703: Countdown to the eggs
- Chapter 702: The Secret of Qinlong City
- Chapter 701: Contact Zhao Chen, I have a secret to tell him
- Chapter 700: Seeking the skin of a tiger
- Chapter 699: Judgment of Sin
- Chapter 698: The gap between fleets
- Chapter 697: Does it look good? It’s made with money.
- Chapter 696: The Madman of the Xiaolong Army
- Chapter 695: Qin Longcheng, I’m here to take your life
- Chapter 694: The Xiaolong Legion is coming!
- Chapter 693: Qin Longcheng must die! I can’t wait even for a day!
- Chapter 692: Chapterurth Legion’s First Medal of Merit
- Chapter 691: Lurking Shadow
- Chapter 690: Five hundred T3 Phantom Thorns!
- Chapter 689: The Fourth Xiaolong Army has arrived!
- Chapter 688: Silence is destruction
- Chapter 687: I hope the kids don’t blame me.
- Chapter 686: No rush, wait a moment.
- Chapter 685: Qinlongcheng’s determination
- Chapter 684: Zerg virus
- Chapter 683: Qin Xiaotian, you deserve to die
- Chapter 682: Lightning Strike on Snow Swallow Star Region
- Chapter 681: Ten days? I’ll get it in ten hours!
- Chapter 680: Special Hive Mothership
- Chapter 679: I am worthy of being your brother, Zhao Chen!
- Chapter 678: Want to play house swap?
- Chapter 677: The Madness of Qinlong City
- Chapter 676: A historical coincidence
- Chapter 675: They have something to do!
- Chapter 674: The two people on trial
- Chapter 673: Dragon Slaying Plan and Star Purgatory Plan
- Chapter 672: Qin Xiaotian’s counterattack plan
- Chapter 671: Only 10,000 coins are missing? Is it important?
- Chapter 670: Anne Lord
- Chapter 669: You’re kidding, Annie!
- Chapter 668: Large military expansion, new Xiaolong commander
- Chapter 667: Xiaolong Special Fleet
- Chapter 666: Qin Xiaotian’s crazy plan
- Chapter 665: As long as you give enough, principles don’t matter.
- Chapter 664: Expelling the Qian Family
- Chapter 663: Want to talk? It depends on your sincerity.
- Chapter 662: Bombard Star City
- Chapter 661: Sanctions on JF-17!
- Chapter 660: Escape to Star City
- Chapter 659: The mysterious technology that disappeared
- Chapter 658: Should we fight or not?
- Chapter 657: I will destroy the Holy Lancer Corps!
- Chapter 656: Holy Glorious Empire - Southern Holy Fleet
- Chapter 655: Total annihilation!
- Chapter 654: Disaster of the Holy Lancers
- Chapter 653: Show it to Saint Cana
- Chapter 652: Deploy Mecha
- Chapter 651: Gorgon’s Salvo
- Chapter 650: Waltz of the Fallen Angels
- Chapter 649: The Army of Light... is it very strong?
- Chapter 648: Nineteen starships
- Chapter 647: The Hongmen Banquet of the Qian Family
- Chapter 646: The Qian family’s borrowed knife to kill
- Chapter 645: You are scared
- Chapter 644: The most powerful family in the Holy Empire
- Chapter 643: Does paint peeling count?
- Chapter 642: The Chu family is here to take you home!
- Chapter 641: Secretary’s Rage
- Chapter 640: Got you!
- Chapter 639: We can collaborate
- Chapter 638: San Cana has a really strong taste
- Chapter 637: Seems to have overlooked something
- Chapter 636: This is absolutely fake!
- Chapter 635: Fireworks for the Qian family
- Chapter 634: The commander told me to take it off.
- Chapter 633: The Little Skeleton enters combat mode
- Chapter 632: I took the bride away
- Chapter 631: I want this bride.
- Chapter 630: Has snatching become a habit?
- Chapter 629: Zhao Chen’s card
- Chapter 628: Young Master of the Qian Family
- Chapter 627: Looking for a good partner? Here’s one ready-made
- Chapter 626: Behind you is Xiaolong
- Chapter 625: Shit-flavored chocolate
- Chapter 624: You can’t change anything, but the Xiaolong Army can
- Chapter 623: How to Tame a Tiger
- Chapter 622: Is this your attitude towards your savior?
- Chapter 621: Commander tearing mecha apart
- Chapter 620: Attack Commander
- Chapter 619: Attacked
- Chapter 618: Qin Xiaotian’s Secret Deal
- Chapter 617: Personal protection by the guards
- Chapter 616: Enemies meet on a narrow road
- Chapter 615: An acquaintance in a strange tavern
- Chapter 614: Star City
- Chapter 613: Luxurious Royal Guard Fleet
- Chapter 612: Zhao Chen’s decision
- Chapter 611: Hell’s Angels are coming!
- Chapter 610: Xue Xiaoxiao’s mission
- Chapter 609: Star Alliance
- Chapter 608: The right agent
- Chapter 607: Snatch food from the tiger’s mouth!
- Chapter 606: Big cat who loves fish
- Chapter 605: Golden Eden
- Chapter 604: Super Ship
- Chapter 603: Continue to expand
- Chapter 602: Commander’s Bloodline
- Chapter 601: Resurrection Medal
- Chapter 600: Xiaolong restricted area
- Chapter 599: Qin Xiaotian’s Secret
- Chapter 598: Coming to steal the job?
- Chapter 597: I have a request
- Chapter 596: Zhao Chen lost contact
- Chapter 595: Growing sister
- Chapter 594: All fear comes from insufficient firepower
- Chapter 593: The Second Xiaolong Corps, here we come!
- Chapter 592: Leviathan Monarch-class Hive Ship
- Chapter 591: This is the responsibility of the interstellar frigate
- Chapter 590: Storm Fortress Starport
- Chapter 589: Dragon Galaxy Defense War
- Chapter 588: Whoever dares to stop the production line will get out!
- Chapter 587: Hundred Thousand Insect Swarm
- Chapter 586: My brother is here
- Chapter 585: Iron Spider
- Chapter 584: Unexpected Enemies
- Chapter 583: Qin Xiaotian made a move
- Chapter 582: New Mission
- Chapter 581: Is Qin Ming dead?
- Chapter 580: Mission accomplished?
- Chapter 579: Deposed the Second Prince
- Chapter 578: Qin Ming’s world turned upside down
- Chapter 577: This is all my savings.
- Chapter 576: Qin Ming wants to become emperor
- Chapter 575: He’s not here!
- Chapter 574: The prey is coming
- Chapter 573: Wait for him to fall into the trap
- Chapter 572: Wash it clean and then sell it
- Chapter 571: This battle can’t be won
- Chapter 570: Beiyan and Xiaolong
- Chapter 569: Loyal Dog Plan, execute!
- Chapter 568: One hundred and twenty thousand? Where did they get those interstellar battleships?
- Chapter 567: The Imperial Princess Fleet, come on!
- Chapter 566: A carnival for His Royal Highness
- Chapter 565: All fleets are ready to jump.
- Chapter 564: Encirclement and annihilation of Chu Changhe
- Chapter 563: This is the burial place of the Chu family
- Chapter 562: The new year starts with accepting tasks!
- Chapter 561: Annie wants to quit!
- Chapter 560: I don’t want this sister anymore, whoever wants her can take her!
- Chapter 559: Super Black Technology
- Chapter 558: Year-end task gift pack
- Chapter 557: Advancement, Commander!
- Chapter 556: Zhao Chen’s Business Empire
- Chapter 555: Chu Changhe’s January Offensive
- Chapter 554: Cheers to our great hero, Annie!
- Chapter 553: Zhao Chen’s Gift
- Chapter 552: Super cheap T4 Star Destroyer
- Chapter 551: The debt collector is coming
- Chapter 550: The Imperial Senate is shaken
- Chapter 549: You wouldn’t... buy on credit, would you?
- Chapter 548: Paladin-class heavy interstellar missile frigate’s star shield matrix
- Chapter 547: Intercept them all!
- Chapter 546: What is the gap?
- Chapter 545: The Real Storm
- Chapter 544: You are the real winner
- Chapter 543: We admit defeat in this game
- Chapter 542: The first battle: Xiaolong wins!
- Chapter 541: The glory of the winner
- Chapter 540: This gun is too solid.
- Chapter 539: Throw it in his face!
- Chapter 538: Turn off the star shield and withstand the attack!
- Chapter 537: Blue-Eyes White Dragon PK Punishment Angel
- Chapter 536: Holy War Duel: Start
- Chapter 535: Three duels begin!
- Chapter 534: Captain Arrangement of Blue-Eyes White Dragon No.1
- Chapter 533: The silver-white star dragon!
- Chapter 532: Their interstellar battleships?
- Chapter 531: Attack of Annie!
- Chapter 530: I don’t even know how to write the word lose
- Chapter 529: Holy War Duel
- Chapter 528: Holy Spirit Man
- Chapter 527: The most powerful interstellar empire
- Chapter 526: This beef leg is so tender
- Chapter 525: It’s you! Blue-Eyes White Dragon!
- Chapter 524: Late quarterly tasks
- Chapter 523: Revenge of the Great White Cat
- Chapter 522: Imperial Civil War
- Chapter 521: The war has begun!
- Chapter 520: We’re taking over the galaxy
- Chapter 519: Parting Ways
- Chapter 518: The little white cat has grown up
- Chapter 517: Follow me
- Chapter 516: A bit of loss
- Chapter 515: Red Lightning’s Strangulation
- Chapter 514: The abandoned eagle
- Chapter 513: How could they have T4?
- Chapter 512: The other party has no martial ethics!
- Chapter 511: What is that eagle doing!
- Chapter 510: If you dare, beat me to death!
- Chapter 509: The Revolutionary Army’s Desperate Situation
- Chapter 508: The former queen
- Chapter 507: Medusa’s Request
- Chapter 506: Charlotte’s Dragon Tigers
- Chapter 505: Come back and I’ll teach you
- Chapter 504: The big white cat bit someone!
- Chapter 503: It depends on whether the teeth of the war hammer can bite!
- Chapter 502: Take care, Marshal!
- Chapter 501: Two major mining groups were established!
- Chapter 500: Not many, only about 20,000...
- Chapter 499: T4 class interstellar frigate
- Chapter 498: Even if there is no opportunity, we must create one and go for it!
- Chapter 497: Little Princess Bloody Seven Stars
- Chapter 496: The Royal Family’s Only Hope
- Chapter 495: The little princess is in my hands
- Chapter 494: What good will it do if I bring your grandfather back?
- Chapter 493: Starfleet disappears into thin air
- Chapter 492: Xue Xiaoxiao’s dream came true
- Chapter 491: These two people must die!
- Chapter 490: The sudden appearance of the Xiaolong Army
- Chapter 489: You don’t need to worry about how my old man will take care of himself.
- Chapter 488: Kick that shit throne over
- Chapter 487: Let’s go meet our father-in-law…
- Chapter 486: Chu family secret guard, greetings to the Marshal!
- Chapter 485: Execution of Chu Changhe
- Chapter 484: Chu Changhe Kills the Emperor
- Chapter 483: Treat our Marquis Beilang well
- Chapter 482: The Future Fortune of Marquis Beilang
- Chapter 481: Brother, avenge me!
- Chapter 480: Zhao Chen! I’ll be waiting for you down there!
- Chapter 479: Today, none of your interstellar battleships can leave
- Chapter 478: Want to surrender? Let Qin Hu tell me in person.
- Chapter 477: Wolverine Hunt
- Chapter 476: Heavy Interstellar Destroyer
- Chapter 475: The interstellar air battle between T3 Phoenix and T4 Star Emperor
- Chapter 474: The first T4 starship to fall
- Chapter 473: Look! Six billion is burning!
- Chapter 472: Three thousand T3-class interstellar battleships
- Chapter 471: Who told you that I only have these interstellar battleships?
- Chapter 470: The interstellar battlefield that everyone is paying attention to
- Chapter 469: The system killed you, don’t blame me
- Chapter 468: They only have 500 ships, and we have 20,000! How can we lose!
- Chapter 467: Anyone who trespasses into the Xiaolong system will die!
- Chapter 466: The sword is sharpened, ready to drink blood
- Chapter 465: I will be their token of surrender
- Chapter 464: You are now my hostage.
- Chapter 463: I really thought it was robbed by me
- Chapter 462: Let go, can’t you see that I don’t want to?
- Chapter 461: T4 Suzaku-class medium-sized interstellar cruiser unveiled!
- Chapter 460: Do they really dare to collide?
- Chapter 459: If it blocks the road, run over it.
- Chapter 458: Her Hero
- Chapter 457: Caged Bird
- Chapter 456: Let me see your brother’s big cannon!
- Chapter 455: Su Lan’s Gratitude
- Chapter 454: Prince Yan’s support
- Chapter 453: T4 Gemini-class heavy interstellar industrial ship
- Chapter 452: Annie said she wasn’t there
- Chapter 451: The third T4 interstellar battleship of the Star Empire!
- Chapter 450: Su Lan’s political marriage
- Chapter 449: How about we make a real play?
- Chapter 448: Zhao Chen is a scumbag who abandoned his wife and children
- Chapter 447: The prince’s party took the lead
- Chapter 446: The eldest sister urged me to get married
- Chapter 445: This sleep is like a dream...
- Chapter 444: Thirty ships? Is that enough?
- Chapter 443: Battleship
- Chapter 442: Annual mission accomplished!
- Chapter 441: I have created this God!
- Chapter 440: This is impossible!
- Chapter 439: This is just the beginning of revenge
- Chapter 438: A real T4 starship
- Chapter 437: Defend the main star!
- Chapter 436: What kind of interstellar frigate is this?
- Chapter 435: Like ramming ships?
- Chapter 434: Stealth warship of unknown origin
- Chapter 433: Wolf King Star Port Fortress
- Chapter 432: Dare to bully my little tiger
- Chapter 431: Seeds buried in Warhammer
- Chapter 430: Sister Charlotte has gained weight
- Chapter 429: A massacre of four hundred against three thousand!
- Chapter 428: Look at the meteor shower
- Chapter 427: I, Charlotte, am back!
- Chapter 426: A month? It won’t take that long.
- Chapter 425: The situation of the White Tiger tribe
- Chapter 424: This is my commander.
- Chapter 423: Rice bag?
- Chapter 422: Big gold mine!
- Chapter 421: The pawn of the prince’s party
- Chapter 420: I, Zhao Chen, want these two galaxies.
- Chapter 419: The Xu family’s situation
- Chapter 418: Military Starport
- Chapter 417: The first "battle damage"
- Chapter 416: The first ship of the T4 Suzaku-class medium-sized interstellar cruiser was launched on trial
- Chapter 415: New flagship! T4!
- Chapter 414: Recruitment plan
- Chapter 413: The Xiaolong Lord is a breakthrough
- Chapter 412: Massive military expansion
- Chapter 411: Workaholic Annie!
- Chapter 410: Why do I hear the sound of an abacus?
- Chapter 409: The little princess’s treasury
- Chapter 408: I have money
- Chapter 407: How many secrets do you have?
- Chapter 406: How about we support the little princess?
- Chapter 405: Zhao Ruyue’s ideological subversion
- Chapter 404: Hot Potato
- Chapter 403: The Lost Starfleet
- Chapter 402: Bite them for me!
- Chapter 401: An unexpected lifesaver
- Chapter 400: I’m here to take the young lady home.
- Chapter 399: Is it true that we can never go back to the Xiaolong galaxy?
- Chapter 398: The Destroyed Royal Fleet
- Chapter 397: The little princess is not of royal blood!
- Chapter 396: The consecration ceremony begins
- Chapter 395: The Second Prince and Prince Yan
- Chapter 394: If you go against it, you will fail.
- Chapter 393: Star Empire·Imperial Star
- Chapter 392: You call this a bowl of noodles?
- Chapter 391: Congratulations on getting a T4 star battleship!
- Chapter 390: Expanding the interstellar missile ship? She might as well sell me out.
- Chapter 389: Completely wiped out? How is that possible!
- Chapter 388: Capture your Black Wolf Princess and make her my commander’s maid
- Chapter 387: Old acquaintance
- Chapter 386: Who defeated me?
- Chapter 385: Xiaolong Bulldozer
- Chapter 384: The interstellar frigate still wants to shit on my head?
- Chapter 383: I’ll take these ten thousand interstellar battleships!
- Chapter 382: Sudden ambush
- Chapter 381: Intercept and block the Warhammer Star Fleet!
- Chapter 380: Zhao Chen’s mysterious strategy
- Chapter 379: Emperor Xingyao summoned and conferred the title
- Chapter 378: The Shock of the Star Empire
- Chapter 377: The eldest prince was attacked and killed
- Chapter 376: Shocking news from the Star Empire!
- Chapter 375: The Secret Reborn
- Chapter 374: Guan Tongtong’s ’Heavenly Life’
- Chapter 373: This money-burning movement is a bit big
- Chapter 372: Strength is gained through fighting
- Chapter 371: First casualty list
- Chapter 370: T3 Triceratops-class interstellar heavy assault frigate ramming ship
- Chapter 369: The indestructibility of the T3 Emperor-class heavy interstellar battleship
- Chapter 368: Ten minutes! Billions of dollars were thrown away
- Chapter 367: Ten Minutes of Destruction
- Chapter 366: The first battle of the T3 Inquisitor-class heavy interstellar missile ship
- Chapter 365: The target is within range
- Chapter 364: How can three hundred interstellar battleships turn the tide of the war?
- Chapter 363: That man, here he comes
- Chapter 362: The two factions united to kill the snake people
- Chapter 361: I am your only lifeline.
- Chapter 360: Reversal of interstellar battlefield
- Chapter 359: The Snakeman’s Super Battleship
- Chapter 358: Queen Medusa’s ’Dagger’
- Chapter 357: Live broadcast of the first battle on the reef
- Chapter 356: Anne’s ’Vacation’
- Chapter 355: Chief Engineer Annie who cannot be contacted
- Chapter 354: Three thousand interstellar battleships
- Chapter 353: Impossible! Beiyan cannot deliver the order
- Chapter 352: Beiyan’s military procurement orders
- Chapter 351: T4 Starship completed
- Chapter 350: The Battle of the Three Powers in the Reef Star Region
- Chapter 349: Mission: Battle for the Reef
- Chapter 348: Situation in the Reef Sector
- Chapter 347: The Queen is going to buy a ship
- Chapter 346: Separation of the Family
- Chapter 345: The dramatic changes of the Li family
- Chapter 344: The Northern Goose Rebellion
- Chapter 343: Is the military procurement order going to be breached?
- Chapter 342: Something happened to Beiyan
- Chapter 341: Food bill comes into effect
- Chapter 340: The Lords’ Act, true or false?
- Chapter 339: Anne’s Small Business
- Chapter 338: Xiaolong Army
- Chapter 337: Anne’s Commendation Ceremony
- Chapter 336: The storm vortex of interest distribution
- Chapter 335: The romance of big ships and big guns
- Chapter 334: Silver Eden
- Chapter 333: Weird T3 interstellar missile ship
- Chapter 332: Orbital bombardment of Zerg planet
- Chapter 331: Battle of Morton Stargate - End
- Chapter 330: We will pave the way for you to attack
- Chapter 329: Carrying out the final combat mission, the machine was ordered to self-destruct
- Chapter 328: There’s no turning back now.
- Chapter 327: Roaring North Wind
- Chapter 326: Strong Fire Dragon
- Chapter 325: Target: T4 Hive Mothership
- Chapter 324: Chu Family Fleet: God of the North Wind
- Chapter 323: Unexpected reinforcements
- Chapter 322: Mobile ’War Fortress’
- Chapter 321: A true interstellar monster
- Chapter 320: T4 Leviathan-class Hive Carrier
- Chapter 319: Hunter-class Leviathan
- Chapter 318: The Battle of Moulton officially begins
- Chapter 317: Level 4 cosmic wormhole
- Chapter 316: Weird mission
- Chapter 315: Nanny Starship·In Place
- Chapter 314: Impeach Zhao Chen?
- Chapter 313: Massacre
- Chapter 312: First Battle against the Zerg
- Chapter 311: You choose your own path
- Chapter 310: Meeting an old friend in a foreign land
- Chapter 309: Because it’s so ugly
- Chapter 308: If you don’t believe it, you can try it.
- Chapter 307: It’s all your fault! Otherwise I would be his brother-in-law
- Chapter 306: My sister is the fiancée of Lord Xiaolong
- Chapter 305: I need more starships.
- Chapter 304: They are both lords, why is there such a big difference?
- Chapter 303: For the overall situation
- Chapter 302: The Crisis of the Chiang Family
- Chapter 300: Hundreds of cosmic wormholes
- Chapter 299: The Insect Plague in the North Wind Star Region
- Chapter 298: Issue a Lord’s Decree
- Chapter 297: A new look for Charlotte
- Chapter 296: You must be tired outside.
- Chapter 295: How about I build you another galaxy?
- Chapter 294: A grandfather’s advice
- Chapter 293: Anne’s Side Job
- Chapter 292: Pink memories
- Chapter 291: Annual tasks with rich rewards
- Chapter 290: Huge fireworks
- Chapter 289: Today’s harvest, three ships
- Chapter 288: T4 interstellar jump ship
- Chapter 287: Mission accomplished, new love
- Chapter 286: Three prisoners
- Chapter 285: Red eyes under the mask
- Chapter 284: Don’t worry, you’ll soon find out who we are.
- Chapter 283: People are more important than fighter planes
- Chapter 282: Our candy is very popular.
- Chapter 281: Time for revenge
- Chapter 280: Terrifying long-range attack capability I
- Chapter 279: T3 aircraft carrier starship?
- Chapter 278: The system task of making trouble
- Chapter 277: Revenge is the fine tradition of our Xiaolong Fleet.
- Chapter 276: Zhao Chen’s new flagship
- Chapter 275: Red Starship
- Chapter 274: Commander, I don’t want to expose your little tricks.
- Chapter 273: Countdown to Revenge
- Chapter 272: Military purchase order of 45 billion star coins
- Chapter 271: T2 Tibetan Mastiff wins military purchase order
- Chapter 270: T2 Tibetan Mastiff·Crown as King
- Chapter 269: The best T2 star destroyer showdown
- Chapter 268: I question the data falsification of this T2 Tibetan Mastiff
- Chapter 267: Incredible offer
- Chapter 266: The starship that crushes in all directions
- Chapter 265: Friendly business? Just give me your ID card.
- Chapter 264: Su Lan’s Melancholy
- Chapter 263: Little Princess of the Empire
- Chapter 262: Governor of the North Wind
- Chapter 261: The confidence of the Feng family father and son
- Chapter 260: Let me see how high you can go
- Chapter 259: Come, call sister-in-law
- Chapter 258: Prepare to fully equip T3 interstellar battleships
- Chapter 257: Phoenix-class heavy aircraft carrier starship
- Chapter 256: Seasonal Mission: T3 Starship
- Chapter 255: The connection between the two star gates
- Chapter 254: Are you going to deny it?
- Chapter 253: We must avenge this
- Chapter 252: I can help you get revenge
- Chapter 251: Bloody Mary Survivor
- Chapter 250: Burning interstellar space station
- Chapter 249: Trigger hidden mission Recruitment
- Chapter 248: Traitor in the Mercenary Group
- Chapter 247: Lion King or Sick Cat?
- Chapter 246: Battle between interstellar battlecruisers
- Chapter 245: Who can come to save you in this place?
- Chapter 244: Please save Chi Tong
- Chapter 243: Interstellar Academy in the Crystal Ball
- Chapter 242: Xiaolong Resource Star Zone
- Chapter 241: Huiyue-class Stargate No. 1: Activated
- Chapter 240: Annie, this is fat.
- Chapter 239: War is always the best way to get rich
- Chapter 238: Your Majesty, would you consider an interstellar missile ship?
- Chapter 237: Such a horrific record
- Chapter 236: Burning Salamander Starport
- Chapter 235: Bombard the Salamanders’ Base Camp Starport
- Chapter 234: Always reciprocate
- Chapter 233: Your T2 interstellar battleship is hacked.
- Chapter 232: The ’overconfident’ T2 Snow Mastiff-class heavy interstellar battleship
- Chapter 231: It’s not that we are incompetent, it’s just that the enemy ships are too strong
- Chapter 230: Interstellar Battleship Dancing with Death
- Chapter 229: And two interstellar missile ships?
- Chapter 228: Little Axe is about to start racing
- Chapter 227: Ride on the face and output, and walk away
- Chapter 226: There’s something wrong with this T3 starship’s shield
- Chapter 225: T3 Phantom Thorn-class Light Interstellar Stealth Bomber Hunting Time
- Chapter 224: Kill me? You are worthy
- Chapter 223: Two ’old friends’
- Chapter 222: Queen Medusa
- Chapter 221: Snake Queen
- Chapter 220: Three thousand starships, swords pointed at the Lion King
- Chapter 219: Head to the Lion Galaxy and fight the Salamanders again
- Chapter 218: The amazing technology of T4 starship
- Chapter 217: Official graduation
- Chapter 216: No one else cares, I, Zhao Chen, will.
- Chapter 215: Fairies can fulfill wishes
- Chapter 214: Starships that only smart people can see
- Chapter 213: Interstellar Mining Ship
- Chapter 212: If you have a T3 aircraft carrier starship, I can consider it.
- Chapter 211: This is the medal I earned with my love’s life.
- Chapter 210: Empire Veteran
- Chapter 209: An old acquaintance in the Reef Star Region
- Chapter 208: Benefits of the Xiaolong Fleet
- Chapter 207: Dwarf City
- Chapter 206: Isn’t it radiant to see you?
- Chapter 205: Ghost Face Girl Red Eyes
- Chapter 204: The Empire’s military procurement orders
- Chapter 203: T3 Huiyue Star Gate
- Chapter 202: Our own star gate
- Chapter 201: From now on it’s called the Lion Galaxy
- Chapter 200: Tell them who is the master of this galaxy now
- Chapter 199: Comparing ships to each other is infuriating
- Chapter 198: I’m going to fuck your flagship right in front of you.
- Chapter 197: T2 Lions’ debut
- Chapter 196: The lands hit by the bombardment were all ruins.
- Chapter 195: Wolf Girl Snow White
- Chapter 194: Xiaolong Fleet
- Chapter 193: Salamander Chief’s Declaration of War
- Chapter 192: Annie has a job and can support you.
- Chapter 191: Congratulations on getting the first batch of dwarf craftsmen
- Chapter 190: Capture the Galaxy
- Chapter 189: Ambassador Anne
- Chapter 188: Burning T3 Arkham-class medium-sized starship
- Chapter 187: Fire strike! Target: enemy fleet flagship
- Chapter 186: T3 Blizzard VST3 Arkham
- Chapter 185: Except for T3, they are all scrap metal
- Chapter 184: The commander is a big liar
- Chapter 183: An interstellar cruiser of unknown origin?
- Chapter 182: The Dwarfs’ Despair
- Chapter 181: Salamanders targeting dwarves
- Chapter 180: Reef
- Chapter 179: The underage hibernation capsule came out to work
- Chapter 178: Charlotte
- Chapter 177: Pulling the T2 Hyena off its sales pedestal
- Chapter 176: T2 Tibetan Mastiff-class medium star destroyer
- Chapter 175: Poking their wallets
- Chapter 174: Senior Zhao Chen
- Chapter 173: Returning to the academy, treated like a hero
- Chapter 172: Anne wants a pay raise
- Chapter 171: Oops! We are short of talent.
- Chapter 170: Anne loves working the most.
- Chapter 169: Bull Head Girl’s Embrace
- Chapter 168: Make a fake thing come true
- Chapter 167: How come this old man looks so handsome?
- Chapter 166: When will I have a sister-in-law?
- Chapter 165: The Mystery of the Big Sister
- Chapter 164: Viscount of the Empire
- Chapter 163: Rewarding crystal? Could it be him?
- Chapter 162: Princess’s personal fleet, arrive
- Chapter 161: Dare to touch my precious grandson-in-law, I will destroy his doghouse
- Chapter 160: I’m here to take our grandson-in-law home.
- Chapter 159: If I say no, what can you do to me?
- Chapter 158: Zhao Chen’s confidante
- Chapter 157: The three big guys from the Blue Star Region gathered together
- Chapter 156: Azure Governor
- Chapter 156: Azure Governor
- Chapter 155: But I, Zhao Chen, am not afraid
- Chapter 154: Narrow your own path
- Chapter 153: I can build you a T4 starship
- Chapter 152: Governor of Chuhe
- Chapter 151: Interstellar stealth bomber?
- Chapter 150: Check this Zhao Chen for me
- Chapter 149: Believe it or not, I will spend a T3 starship to kill you
- Chapter 148: You order, we don’t charge a penny
- Chapter 147: ’Swindler’ Zhao Chen
- Chapter 146: You stink.
- Chapter 145: Is this white tiger pure?
- Chapter 144: What did you say? I didn’t hear you clearly.
- Chapter 143: What are you doing on my starship?
- Chapter 142: Launch an academy ship?
- Chapter 141: Swarm Breakout
- Chapter 140: Sea of Insects
- Chapter 139: The future beauty
- Chapter 138: Just the saliva of two insects
- Chapter 137: Blizzard’s bow gun
- Chapter 136: T3 Blizzard’s First Star War
- Chapter 135: T3 Hive Mothership
- Chapter 134: Hand-tear mecha
- Chapter 133: Thunder Beast Attack
- Chapter 132: I thought... I was going to die...
- Chapter 131: How could you not invite me to such an exciting party?
- Chapter 130: If you can’t break it, just jump for me
- Chapter 129: T3 interstellar battleship enters the atmosphere
- Chapter 128: Snowstorm Extreme Cruise Mode
- Chapter 127: Choose the shortest one between two points!
- Chapter 126: No one will come to rescue us.
- Chapter 125: Target! The Swarm
- Chapter 124: It’s called a blizzard
- Chapter 123: If you don’t save me, I will save you myself.
- Chapter 122: Zhao Waner encounters crisis
- Chapter 121: T3 Super Soldier Potion
- Chapter 120: The first T3 interstellar battleship was launched
- Chapter 119: Promotion to fifth grade
- Chapter 118: Are you willing to cooperate with our Chu family?
- Chapter 117: The eldest lady of the Chu family
- Chapter 116: The perfect ecosystem on the starship
- Chapter 115: T2 Bronze Eden-class starship
- Chapter 114: The Old Man of the Chu Family
- Chapter 113: Ten times the reward
- Chapter 112: Need to pay extra
- Chapter 111: Reception of a Brigadier General
- Chapter 110: We need an explanation
- Chapter 109: Something Wrong with the Escort Mission
- Chapter 108: Galactic Alliance Prohibition
- Chapter 107: T2 Lion King class heavy interstellar missile ship
- Chapter 106: A Starship Missile Ship
- Chapter 105: T2 starship vs. T3 starship
- Chapter 104: Mechanical T3 starship
- Chapter 103: How can a T2 starship have a star shield?
- Chapter 102: Starship also plays dismemberment?
- Chapter 101: Aircraft carrier starship as bait
- Chapter 100: Warp Jammer
- Chapter 99: Escort mission: Departure
- Chapter 98: Annie...can you...eat this?
- Chapter 97: Anne the Dwarf
- Chapter 96: Interstellar Craftsmen - Dwarves
- Chapter 95: Galactic Alliance and the Machines
- Chapter 94: Imperial Flagship - God of the North Wind
- Chapter 93: Northern Galaxy 3
- Chapter 92: Military escort mission
- Chapter 91: Four Starship Technologies
- Chapter 90: Li Yaqi’s Business Legend
- Chapter 89: One sells his sister, the other sells his schoolmate
- Chapter 88: Small ship hits big ship
- Chapter 87: It’s just a tough interstellar frigate.
- Chapter 86: It’s actually an interstellar frigate?
- Chapter 85: Triple Assessment Credits
- Chapter 84: Then let’s play a game
- Chapter 83: Are you crying?
- Chapter 82: The best-selling T1 starship
- Chapter 81: Annual and quarterly tasks
- Chapter 80: Stars and bright moon, swear to follow you till death
- Chapter 79: Promoted to Fleet Commander
- Chapter 78: The apple of the eye of two imperial dukes
- Chapter 77: I don’t have time. I’m busy building a starship.
- Chapter 76: Chu Xuan, a prominent figure
- Chapter 75: Golden Emblem: Chu
- Chapter 74: Preparing to build the third interstellar battleship
- Chapter 73: The mysterious origin of the Black Dragon Fleet
- Chapter 72: A mini version of the armored behemoth?
- Chapter 71: I’m afraid this person is obsessed with money.
- Chapter 70: The triumphant return of Blizzard Zero
- Chapter 69: Is this going to hit the ship?
- Chapter 68: Speed up and hit me
- Chapter 67: White Tiger General Charlotte
- Chapter 66: Insect Swarm Tactics
- Chapter 65: Just two starships?
- Chapter 64: Hive Ship
- Chapter 63: They really dare to fire
- Chapter 62: Target! Arctic Fox Galaxy Edge·P331 Asteroid
- Chapter 61: Interstellar Zerg
- Chapter 60: T2 Hammer-class heavy interstellar industrial ship
- Chapter 59: Xiaolong Fleet
- Chapter 58: They could have endured the darkness, as long as they had never seen the light.
- Chapter 57: Succubus’s Cry
- Chapter 56: Wherever you want to go, I can take you there.
- Chapter 55: The succubi who are full of food
- Chapter 54: This is not a starship, this is clearly heaven
- Chapter 53: Succubus Lilith
- Chapter 52: Interstellar Succubus
- Chapter 51: Female soldiers’ uniforms
- Chapter 50: I want to achieve ’food freedom’
- Chapter 49: Building a new city on the ruins
- Chapter 48: Zhao Chen’s Death List
- Chapter 47: Butcher Zhao Chen
- Chapter 46: If the living can’t come, the dead will do.
- Chapter 45: I, Zhao Chen, am back
- Chapter 44: From the moment they stepped into this place, surrender was not an option.
- Chapter 43: We surrender
- Chapter 42: Does this T2 aircraft carrier starship have a star shield?
- Chapter 41: One shot kill · T2 heavy star destroyer
- Chapter 40: The first battle of the T2 Queen Bee-class heavy aircraft carrier starship
- Chapter 39: The game begins, Lord Baron
- Chapter 38: The Storm in the Xiaolong Galaxy
- Chapter 37: Go to Xiaolong System
- Chapter 36: Interstellar Industrial Ship
- Chapter 35: T2 Queen Bee-class heavy aircraft carrier starship completed
- Chapter 34: I took away my eldest sister’s wish
- Chapter 33: I want to build a ship
- Chapter 32: Stargate Jump Arctic Fox Starport
- Chapter 31: Blizzard Zero’s first warp trip
- Chapter 30: Something happened to the Xiaolong Galaxy
- Chapter 29: I want a fleet of hope! Not the walking dead!
- Chapter 28: We can have rice for every meal...
- Chapter 27: He even packed
- Chapter 26: You can sell that T2 Bald Eagle.
- Chapter 25: Just kneel down.
- Chapter 24: Brother Zhaochen, can I see your cannon?
- Chapter 23: Three million star coins, buyout
- Chapter 22: Mysterious Starship Technology
- Chapter 21: Zhao Chen’s T2 super aircraft carrier starship
- Chapter 20: It’s you! Aircraft carrier starship
- Chapter 19: Selling Starship Technology
- Chapter 18: Zhao Chen won?
- Chapter 17: A single shot sealed the victory
- Chapter 16: fire
- Chapter 15: Show us our 1200mm cannon! Fuck him!
- Chapter 14: The Ten-Minute Battle of the White-Haired Beast-Eared Girl
- Chapter 13: The showdown begins! Bald Eagle vs. Blizzard Zero
- Chapter 12: Zhang Haoran’s Starship T2 Bald Eagle Class Light Interstellar Cruiser
- Chapter 11: You don’t believe me? Then I will win for you.
- Chapter 10: First test voyage of the Blizzard Zero
- Chapter 9: Vice Captain: Beast Girl Charlotte
- Chapter 8: I got a white-haired half-beast girl
- Chapter 7: The first starship: Storm Zero
- Chapter 6: Assembling the starship
- Chapter 5: Exchange for three broken starships? This guy must be crazy
- Chapter 4: Starship Duel
- Chapter 3: The Waste Baron’s Fiancee
- Chapter 2: A starfleet that can only recruit female soldiers?
- Chapter 1: The system is messing up
ZhaoChen lookedatAkatong,whohadtakenoffhermask.
ntheleftsideofherforeheadwasaredhorn,andtherewasalsooneontheright,butitwasabrokenhorn,lookingasifithadbeencutoffbysomesharpobject.
hepartofherrightcheekcoveredbythemaskwasnotmuchdifferentfromherleft,alsohavingsomeblackstripes.
tseemedthemaskwasspecificallytocovertheredhornonAkatong'sforehead.
Redhorn...black exture onhercheek...
Apieceofknowledgefromhistimeatthe orthStarStarshipMilitaryAcademy surfacedin ZhaoChen'smind.
he DemonRace,inherentlypossessingstrongcombatabilities,wasonceknownasanaturallywarlikerace.heirspecieswassimilartohumans,buttheyhadnaturalhornsandirregularblackpatternsontheirbodies. 𝑓𝘳𝑒𝑒𝓌𝘦𝘣𝘯ℴ𝑣𝘦𝑙.𝘤𝑜𝑚
"Youarefromthe DemonRace?" ZhaoChen asked.
Akatongnodded:"Yes,originallybelongedtothe DemonRace,butduetocertainreasons,myparents'branchofthefamilywashunteddownandfledthe DemonRace.
Decadesago,theywanderedtothisareaofthe alacticAlliance."
"Wanderedover?'vereadrecordsthatthe DemonRace's Starfleet onceappearedinthe alacticAlliance'sterritory,butforsomeunknownreason,theyneverappearedagain," ZhaoChen inquiredcuriously.
"heplacewherethe DemonRace livesisveryfarfromhere,ifcalculatedbydirection.
he MechanicalRace isrightinthemiddleofthetwo,makingasinglevoyageverydifficult.Plus,the DemonRace isconstantlyfightingitsnaturalenemies.
t'ssimilartotherelationshipbetweenyour alacticAlliance andthe MechanicalRace.aturally,theydon'thavetimetogetinvolvedinaffairsofotherdistantuniverses.
hisisalsowhymyparentschosetofleehere.
Becausehere,aslongaswedisguiseourhorns,basicallynoonewillrecognizeusasthe DemonRace,"Akatongsaid.
SoAkatonghadsuchastory.
"Report,thetarget Starport hasbeencompletelycontrolledbyus. BigyeWang,theleaderoftheslavetraders,hasbeencapturedbyourmechsquadandisonhisway!" ilith reportedfromtheside.
"ndthebattleassoonaspossible.heyshouldhavesentoutadistresssignaltotheirmasterbehindthescenesearlier.Wemustquicklyfinishthebattleandevacuatefromhere," ZhaoChen ordered.
ethenlookedatAkatongnexttohim:"We'lltalkmoreaboutyourmatterwhenwegetback.Youcontinuewithyourworkfornow."
Akatonglookedatthe Commander,alittlestunned.
"What'swrong?" ZhaoChen lookedatAkatong'ssomewhatsurprisedexpression.
"You...you'renotblamingme?...hidfromyou...that'mfromthe DemonRace..."Akatongaskedcautiously.
ZhaoChen chuckled:"What'stheproblemwiththat?veryonehastheirownsecrets.justneedtoknowthatyou,Akatong,arediligentlyworkingforme.
thasnothingtodowithwhetheryouarefromthe DemonRace orwhetheryouhavehornsonyourhead."
"But...the alacticAlliance...hasalwaysbeenwaryofus.versincetheDemon Starfleet visitedandthendisappearedalongtimeago.
ur DemonRace hasbecomeoneoftheinterstellarracestheycloselymonitorandsearchfor,"Akatongsaidwithabittersmile:"hat'salsowhywearamaskanddisguisemyidentity."
ZhaoChen shruggedandsaid:"t'sunderstandablethatthe alacticAlliance wouldbewaryofsuchamysteriousexistenceastheDemonrace,fortheirownsecurity.here'snothingwrongwiththat.
Buttrustyou,becauseyou,Akatong,arenowmycrewmember."
Afterspeaking,hetappedAkatong'sheadandurged:"Alright,hurryupandgettowork.don'tcareifyou'resome DemonRace ornot,ifyouslackoffonthejob,yoursalarywillbededucted."
Finally, ZhaoChen didn'tforgettoteaseher.
Feelingthat ZhaoChen'sattitudetowardsherhadn'tchangedatall,Akatongsmiled.
hiswasthefirsttimeshehadsmiledsohappilysinceputtingonhermask.
tturnedoutthatinthisland,therereallywerepeoplewhodidn'tmindtheirexistence★𝐍𝐨𝐯𝐞𝐥𝐢𝐠𝐡𝐭★atall.
"Yes, Commander!"Akatongsaidseriously,thenreturnedtoherpost.
hebattlewasstillongoing,butitwasnownearingitsend.
Undertherepeateddevastationofthe 3Blizzard, 2SnowMastiff, 2BlackRhino,andtheoverwhelming nterstellarFighter and nterstellarDroneSwarm,theslavetraders' Starfleet couldnolongerholdon.
heygraduallylostthewilltofightandbegantoflee.
odaywasdifferentfromthepast. ZhaoChen hadenough nterstellarWarship toencircleandannihilatethesefleeingenemy nterstellarWarship.
Afterall,intermsofspeed,whocouldoutrunthe 3Blizzard?
"ffertermsofsurrendertotheenemyships.ellthemthatany nterstellarWarship thatshutdowntheirinterstellarenginesandsurrenderwillnotbedestroyed," ZhaoChen told ilith.
"Yes," ilith immediatelyrelayedtheorder.
Subsequently,the XiaolongFleet'ssurrenderannouncementechoedonthepublicchannelofthisstarsector.
hisledtoalargenumberof nterstellarWarship beginningtosurrender.Afterall,theycouldn'twinthefight,andtheycouldn'tescape,sotheycouldonlysurrenderobediently,seekingaglimmerofhope!
Atthisverymoment,threepeople,confinedinacage,hadbeentransferredtothe shuttle hangarofthe 3Phoenix-classeavyCarrierStarship.
"ilith,'llleavethingsheretoyoufornow.
Collectasmany nterstellarransportShipsaspossible.Afterthebattleends,transferalltherescuedslavestothetransportships," ZhaoChen told ilith.
"Yes," ilith said.
hen ZhaoChen lookedatAkatong:"Weshouldgomeetourthreeopponents.estimatethey'restillcompletelybewilderedbythissuddenbattle.
Atleast,let'smakesuretheydiewithunderstanding."
Akatongnodded.
Soon, ZhaoChen andAkatongarrivedoutsidethehangarwherethethree'prisoners'werebeingheld.
Beforeevenenteringthehangar,asharpshoutcouldbeheard.
"'mwarningyou!WehaveisighnesstheSecondPrinceandisighnessthe hirdPrince ofthe Starlightmpire behindus!fyoudaretodoanythingtous.
heSecondPrinceand hirdPrince willnotletyouoffeasily!" ZhaoChen lookedover.hespeakerwasascrawnyman.
ZhaoChen hadseenthedata.hispersonwasthesecond-in-commandofthisgroupofslavetraders,nicknamedSkinnyMonkey.
ohisleftandrightwere BigyeWang,theleader,and hirdScarface.
heappearanceof ZhaoChen andAkatongalsoattractedtheattentionofthesethree.
specially ZhaoChen,because ZhaoChen wastheonlymaletheyhadseensincearrivinghere.
ButuponseeingAkatongnextto ZhaoChen,theirinitialconfusionquicklyturnedintosurprise.
"YouareAkatongofthe BloodyMaryMercenaryroup!" hirdScarface wasthefirsttorecognizetheidentityofthewomanbeforethem.
BecauseAkatongwasnotwearinghermaskatthismoment,althoughtheydidn'trecognizeheridentityimmediately,whentheysawtheverysymbolicswordatherwaist.
hat'swhentheyrecognizedherasAkatong.
"Didn'texpectustomeethere,didyou?
Whenyouorderedthemassacreofmy BloodyMaryMercenaryroup'sheadquarters,youneverimaginedyou'dhaveadaylikethis,didyou!"Akatonggrippedherswordhilt,hereyesfullofrage.
- Chapter 1010: The Secret of the Existence of the Mechanical Race
- Chapter 1009: Ancient Empire
- Chapter 1008: Big changes are going to happen
- Chapter 1007: Counterattack Plan
- Chapter 1006: The Devil’s Fury
- Chapter 1005: Xiaolong Guard Fleet!
- Chapter 1004: Terror of the Scarlet Death
- Chapter 1003: Four T5 models in one year?
- Chapter 1002: The King of the North
- Chapter 1001: A plan that kills two birds with one stone
- Chapter 1000: Ge Hui’s Oracle
- Chapter 999: The story of the doctor
- Chapter 998: Doctor? Mechanical Prophet
- Chapter 997: Confrontation on the Planet
- Chapter 996: Holy Land of the Mechanicus
- Chapter 995: King of the Hill!
- Chapter 994: The strongest meat shield
- Chapter 993: There are many secrets hidden here
- Chapter 992: A Trap?
- Chapter 991: Mechanicus
- Chapter 990: Pick up the biggest one
- Chapter 989: Holy Land of the Prophet
- Chapter 988: T5 sequence of the mechanical family
- Chapter 987: Secret Starship Factory
- Chapter 986: Whistleblower Military Operation
- Chapter 985: Negotiate terms
- Chapter 984: Machines and Demons
- Chapter 983: There can only be one winner!
- Chapter 982: Special starship weapons technology
- Chapter 981: Commander’s Gift
- Chapter 980: 100 trillion orders
- Chapter 979: The T5 really can’t be sold.
- Chapter 978: Military purchase orders worth hundreds of trillions of star coins
- Chapter 977: Quote for the Xiaolong starship
- Chapter 976: The glorious victory of the Holy Dragon Angel Legion!
- Chapter 975: Make a big splash!
- Chapter 974: Tilia’s saturation fire attack
- Chapter 973: Reinforcements? Just 10,000 ships?
- Chapter 972: Holy Dragon Angel Legion
- Chapter 971: Tilia’s Preparation
- Chapter 970: Anne’s Boudoir
- Chapter 969: United front!
- Chapter 968: The Demonic Attack
- Chapter 967: The Devil’s Castle
- Chapter 966: Three new ships
- Chapter 965: The Swarm Mission Completed
- Chapter 964: Can’t this universe be a little more stable?
- Chapter 963: Can you beat me?
- Chapter 962: Internal strife among the mechanical race
- Chapter 961: To our heroes
- Chapter 960: The insect disaster is over
- Chapter 959: Others are watching
- Chapter 958: The Leviathan Shaman-class hive carrier has fallen!
- Chapter 957: We did it!
- Chapter 956: The only chance!
- Chapter 955: A raid of fifteen starships!
- Chapter 954: The last move
- Chapter 953: You only have one hour!
- Chapter 952: The horn of counterattack!
- Chapter 951: Making a feint to the east and attacking in the west
- Chapter 950: Charlotte Assault
- Chapter 949: Combat Operations
- Chapter 948: Leader of the Swarm
- Chapter 947: Your AI is pretty average.
- Chapter 946: Charlotte’s Bug Slayer
- Chapter 945: Pluto kills the Leviathan King-class hive mothership!
- Chapter 944: Charlotte’s Battle Plan
- Chapter 943: If there is no road, make one.
- Chapter 942: Changes in the No. 4 Main Camp
- Chapter 941: If you keep wasting time, you will die slowly.
- Chapter 940: The stalemate of the battle!
- Chapter 939: Swarm of Insects
- Chapter 938: This battle! I will not retreat until the Zerg are destroyed!
- Chapter 937: Swarm Frenzy: On
- Chapter 936: War is coming!
- Chapter 935: Last three hours!
- Chapter 934: Give the old man my entire great-grandchild
- Chapter 933: Mr. Chu’s little secret
- Chapter 932: Clean up every bug
- Chapter 931: Let’s deal with these little troubles first.
- Chapter 930: Assemble! Two million starships!
- Chapter 929: Emergency war mobilization of the three empires
- Chapter 928: Extreme pull
- Chapter 927: Swarm frenzy?
- Chapter 926: Opened quarterly tasks
- Chapter 925: The hunted demon
- Chapter 924: Want to leave? Have you asked me?
- Chapter 923: Roar of the Cannon
- Chapter 922: Holy Redeemer
- Chapter 921: One versus Three
- Chapter 920: Su Lan’s aircraft carrier star fleet
- Chapter 919: T5 Fire Kylin Class Heavy Aircraft Carrier Starship Debut
- Chapter 918: This artificial intelligence has more than 100 million words
- Chapter 917: T5 Dragon Emperor Interstellar Command Ship - In Position
- Chapter 916: The demon army is coming
- Chapter 915: Maybe it’s just a performance.
- Chapter 914: The Storm Is Coming
- Chapter 913: The first collaboration with the Mechanoids
- Chapter 912: You don’t want to lose us as an ally, do you?
- Chapter 911: Alliance with the Angels
- Chapter 910: Second meeting
- Chapter 910: Second meeting
- Chapter 909: A little surprise prepared by Zhao Chen
- Chapter 908: Inspection
- Chapter 907: The military procurement order...is it really completed?
- Chapter 906: Interstellar Industrial Base Completed!
- Chapter 905: The crisis is here again!
- Chapter 904: Big money sponsor!
- Chapter 903: The first wave of military purchase orders with the Angels
- Chapter 902: The Three Angel Kings
- Chapter 901: The Holy Mountain among the Stars
- Chapter 900: The Angelic System
- Chapter 899: Angelic Civilization
- Chapter 898: The Secret of the Mechanoids
- Chapter 897: It better not be you who did this!
- Chapter 896: Imprisonment? Imprisonment? Or dissection of my brain?
- Chapter 895: The supreme ruler of the mechanical race
- Chapter 894: Pluto lost contact
- Chapter 893: Sudden crisis
- Chapter 892: Befriend or destroy
- Chapter 891: Prepare to set off to the Angel Tribe
- Chapter 890: T5 Holy Redeemer and T5 Fire Kirin
- Chapter 889: Technology of T5 Dragon King
- Chapter 888: One step slow, every step slow!
- Chapter 887: The first habitable planet
- Chapter 886: Commander: The Temptation of Work
- Chapter 885: T5 technology is explosive!
- Chapter 884: It’s New Year’s Eve again
- Chapter 883: The decision of the Red Demon Marshal
- Chapter 882: Resurrection from the dead
- Chapter 881: Sad celebration party
- Chapter 880: Build a military base
- Chapter 879: Lilith’s future plans
- Chapter 878: How about you sit down?
- Chapter 877: Hard to guard against
- Chapter 876: T5 Super Soldier Potion
- Chapter 875: Interstellar command ship!
- Chapter 874: System Gift Pack
- Chapter 873: The Desperate Demon Fleet
- Chapter 872: The Hunted Flagship: T5 Terrorblade
- Chapter 871: Hunting of the Lightning Ghost
- Chapter 870: How many T5s do they have!
- Chapter 869: Chaos Knight’s First Battle
- Chapter 868: Let the cub go, hit the calf
- Chapter 867: Demon’s Terrorblade
- Chapter 866: Pain and happiness
- Chapter 865: This will be their cemetery.
- Chapter 864: The end is also the beginning!
- Chapter 863: We can’t let them pass!
- Chapter 862: Build a waterway!
- Chapter 861: Chi Tong and Su Lan’s cooperation
- Chapter 860: You only have four hours
- Chapter 859: The situation suddenly changed!
- Chapter 858: Cautious Red Demon Legion Commander
- Chapter 857: The demon crisis strikes again
- Chapter 856: I choose to stay
- Chapter 855: Rapid service
- Chapter 854: Final sprint stage
- Chapter 853: The Great Infrastructure Era of the Star Empire
- Chapter 852: Uncrowned King
- Chapter 851: Red Demon Marshal
- Chapter 850: Put your hope on a human race?
- Chapter 849: Angel’s Request
- Chapter 848: Contact Angel Tribe
- Chapter 847: Saint Family? Sorry, I have destroyed them.
- Chapter 846: Saints’ diplomatic partners
- Chapter 845: This is a misunderstanding
- Chapter 844: Holy Angel Queen
- Chapter 843: My daughter is going to be the empress?
- Chapter 842: Ancient etiquette
- Chapter 841: The Fallen Imperial Senate
- Chapter 840: Left hand lives, right hand dies
- Chapter 839: Santa Canna’s Plan
- Chapter 838: Legendary Starship
- Chapter 837: The End of the Saints
- Chapter 836: The ugliness of the catastrophe
- Chapter 835: This empire can only have one voice
- Chapter 834: I’d give it everything for this
- Chapter 833: The third generation of Xiaolong generals are activated
- Chapter 832: Release T3 permissions
- Chapter 831: Warhammer Star Federation Kingdom: Announced
- Chapter 830: How about we go on vacation?
- Chapter 829: Anne’s Holiday Plans
- Chapter 828: Demon Starship Interior
- Chapter 827: Anne’s Vacation
- Chapter 826: Permissions enabled
- Chapter 825: We need more starships
- Chapter 824: The gears of fate begin to turn
- Chapter 823: The Dragon Tribe is willing to listen to the arrangements
- Chapter 822: What’s the use of building more starships like this?
- Chapter 821: Sisters united
- Chapter 820: The demon fleet was defeated
- Chapter 819: Xiaolong Legion PK Demon Fleet
- Chapter 818: Interstellar air combat
- Chapter 817: The Despair and Collapse of the Demon Commander
- Chapter 816: Will he be out of firepower?
- Chapter 815: It’s really a T5!
- Chapter 814: Legendary warships, shining debut
- Chapter 813: The target airspace has been cleared, and space jump has started
- Chapter 812: A Flame of Hope
- Chapter 811: Waiting for our support to arrive
- Chapter 810: The battle situation changed suddenly!
- Chapter 809: How dare you show your fangs to mere prey?
- Chapter 808: Emergency
- Chapter 807: The Fate of Saint Canna
- Chapter 806: My friend Santa Cana
- Chapter 805: The mess of the empire
- Chapter 804: The final T5 mall mission
- Chapter 803: My tribe’s Nizi is so moist
- Chapter 802: The enemy of my enemy is my friend
- Chapter 801: Five Demon T4 Star Wars
- Chapter 800: Demon Fleet Information
- Chapter 799: Establish a new alliance and fight against the demons together!
- Chapter 798: Bro? Did you get the wrong script?
- Chapter 797: A blatant threat
- Chapter 796: T5 level mission rewards!
- Chapter 795: Final annual mission
- Chapter 794: The situation of the dragon tribe
- Chapter 793: Two empires together
- Chapter 792: The dragon fleet was completely wiped out?
- Chapter 791: Is the Dragon Emperor gone?
- Chapter 790: Two major events occurred!
- Chapter 789: The two confused dragon princesses
- Chapter 788: The T5 Starship that breaks the balance
- Chapter 787: Kill all enemies with one sword
- Chapter 786: Exceeding the critical value? What kind of monster is that!
- Chapter 785: Second attack mode: Pluto’s Sword
- Chapter 784: The first battle of the T5 Pluto-class star dreadnought was a success
- Chapter 783: The Lost Holy Wings
- Chapter 782: Pluto Realm: Start
- Chapter 781: The beast from deep space
- Chapter 780: Holy Wings Legion
- Chapter 779: He will come as a king
- Chapter 778: Each with his own agenda
- Chapter 777: Blanche and Leona’s Disagreement
- Chapter 776: Warhammer United Civil War begins
- Chapter 775: Millions of interstellar battleships VS Xiaolong Army
- Chapter 774: War begins
- Chapter 773: Pressure at the conference table
- Chapter 772: The first T5 was completed
- Chapter 771: Find the area of Leona’s shadow
- Chapter 770: Zhao Chen VS Dragon Princess
- Chapter 769: The grumpy dragon girl Leona
- Chapter 768: The surrender of the two clan leaders
- Chapter 767: Leona’s Request
- Chapter 766: Winning over neutral tribes
- Chapter 765: Black Fox’s Reward
- Chapter 764: This piece of trash is worth 5 billion?
- Chapter 763: Watch Your Attitude
- Chapter 762: Blood of the Black Tiger Mountain
- Chapter 761: ransom?
- Chapter 760: Warhammer and Glory collaboration
- Chapter 759: Disobedient chess pieces should not appear on the chessboard
- Chapter 758: The story of the fox tribe
- Chapter 757: The Fate of the Fox Tribe
- Chapter 756: Fox Queen
- Chapter 755: Recapture the Black Tiger Star Region
- Chapter 754: Charlotte’s unyielding spirit
- Chapter 753: It’s okay, I’m here
- Chapter 752: Day of Judgment
- Chapter 751: I am willing to bear the consequences of any decision she makes.
- Chapter 750: Massacre of the Black Tiger King’s Legion
- Chapter 749: Bloody White Tiger Emblem
- Chapter 748: The final scene of Black Tiger Prime
- Chapter 747: The Blood Debt of the Black Tiger King Naval Port
- Chapter 746: Lightning Attack Black Tiger King Military Port
- Chapter 745: Target: Black Tiger Star Region
- Chapter 744: What exactly is in the Xiaolong galaxy?
- Chapter 743: Guide to Avina
- Chapter 742: T5 level technology!
- Chapter 741: Spider Queen Elise’s Shock
- Chapter 740: Panic Anne
- Chapter 739: Super Worker: Spider Queen Elise
- Chapter 738: Lilith and Charlotte’s ’common hatred’
- Chapter 737: Visit the Xiaolong system
- Chapter 736: The Spider Queen and the Harpy
- Chapter 735: Dragon Princess
- Chapter 734: This war is too costly.
- Chapter 733: Beast Alliance
- Chapter 732: I’ll treat you to hot pot
- Chapter 731: Slaughtering chickens and pigs
- Chapter 730: The Hunt After the Fireworks Show
- Chapter 729: The first battle of the Warhammer of the Xiaolong Legion
- Chapter 728: Xiaolong Legion VS Dragon Fleet
- Chapter 727: No tears until the coffin
- Chapter 726: The betrayal of the peacemakers
- Chapter 725: The Revolutionary Army’s Parliamentary Divisions
- Chapter 724: The Fifth Army’s Commander
- Chapter 723: The next strategic goal: Warhammer!
- Chapter 722: Internal Troubles of the Revolutionary Army
- Chapter 721: Let them stare into the abyss
- Chapter 720: Charlotte’s Permanent Meal Card
- Chapter 719: Super military procurement order
- Chapter 718: The Empress’s Reward
- Chapter 717: The Strongest Man in the Empire
- Chapter 716: A father is honored by his daughter
- Chapter 715: Li Wei’s Story
- Chapter 714: My brothers are gone...
- Chapter 713: Two modes of T4 Thunder Warrior
- Chapter 712: The elder sister’s obsession
- Chapter 711: The Man Behind the Star Empire
- Chapter 710: The largest military enterprise in the future of the Xingyao Empire
- Chapter 709: Qin Xiaotian and Dr.
- Chapter 708: The situation has changed dramatically
- Chapter 707: What does Annie, that little brat, know?
- Chapter 706: Lilith shows up halfway
- Chapter 705: Am I the only one who can see this?
- Chapter 704: Terror is coming
- Chapter 703: Countdown to the eggs
- Chapter 702: The Secret of Qinlong City
- Chapter 701: Contact Zhao Chen, I have a secret to tell him
- Chapter 700: Seeking the skin of a tiger
- Chapter 699: Judgment of Sin
- Chapter 698: The gap between fleets
- Chapter 697: Does it look good? It’s made with money.
- Chapter 696: The Madman of the Xiaolong Army
- Chapter 695: Qin Longcheng, I’m here to take your life
- Chapter 694: The Xiaolong Legion is coming!
- Chapter 693: Qin Longcheng must die! I can’t wait even for a day!
- Chapter 692: Chapterurth Legion’s First Medal of Merit
- Chapter 691: Lurking Shadow
- Chapter 690: Five hundred T3 Phantom Thorns!
- Chapter 689: The Fourth Xiaolong Army has arrived!
- Chapter 688: Silence is destruction
- Chapter 687: I hope the kids don’t blame me.
- Chapter 686: No rush, wait a moment.
- Chapter 685: Qinlongcheng’s determination
- Chapter 684: Zerg virus
- Chapter 683: Qin Xiaotian, you deserve to die
- Chapter 682: Lightning Strike on Snow Swallow Star Region
- Chapter 681: Ten days? I’ll get it in ten hours!
- Chapter 680: Special Hive Mothership
- Chapter 679: I am worthy of being your brother, Zhao Chen!
- Chapter 678: Want to play house swap?
- Chapter 677: The Madness of Qinlong City
- Chapter 676: A historical coincidence
- Chapter 675: They have something to do!
- Chapter 674: The two people on trial
- Chapter 673: Dragon Slaying Plan and Star Purgatory Plan
- Chapter 672: Qin Xiaotian’s counterattack plan
- Chapter 671: Only 10,000 coins are missing? Is it important?
- Chapter 670: Anne Lord
- Chapter 669: You’re kidding, Annie!
- Chapter 668: Large military expansion, new Xiaolong commander
- Chapter 667: Xiaolong Special Fleet
- Chapter 666: Qin Xiaotian’s crazy plan
- Chapter 665: As long as you give enough, principles don’t matter.
- Chapter 664: Expelling the Qian Family
- Chapter 663: Want to talk? It depends on your sincerity.
- Chapter 662: Bombard Star City
- Chapter 661: Sanctions on JF-17!
- Chapter 660: Escape to Star City
- Chapter 659: The mysterious technology that disappeared
- Chapter 658: Should we fight or not?
- Chapter 657: I will destroy the Holy Lancer Corps!
- Chapter 656: Holy Glorious Empire - Southern Holy Fleet
- Chapter 655: Total annihilation!
- Chapter 654: Disaster of the Holy Lancers
- Chapter 653: Show it to Saint Cana
- Chapter 652: Deploy Mecha
- Chapter 651: Gorgon’s Salvo
- Chapter 650: Waltz of the Fallen Angels
- Chapter 649: The Army of Light... is it very strong?
- Chapter 648: Nineteen starships
- Chapter 647: The Hongmen Banquet of the Qian Family
- Chapter 646: The Qian family’s borrowed knife to kill
- Chapter 645: You are scared
- Chapter 644: The most powerful family in the Holy Empire
- Chapter 643: Does paint peeling count?
- Chapter 642: The Chu family is here to take you home!
- Chapter 641: Secretary’s Rage
- Chapter 640: Got you!
- Chapter 639: We can collaborate
- Chapter 638: San Cana has a really strong taste
- Chapter 637: Seems to have overlooked something
- Chapter 636: This is absolutely fake!
- Chapter 635: Fireworks for the Qian family
- Chapter 634: The commander told me to take it off.
- Chapter 633: The Little Skeleton enters combat mode
- Chapter 632: I took the bride away
- Chapter 631: I want this bride.
- Chapter 630: Has snatching become a habit?
- Chapter 629: Zhao Chen’s card
- Chapter 628: Young Master of the Qian Family
- Chapter 627: Looking for a good partner? Here’s one ready-made
- Chapter 626: Behind you is Xiaolong
- Chapter 625: Shit-flavored chocolate
- Chapter 624: You can’t change anything, but the Xiaolong Army can
- Chapter 623: How to Tame a Tiger
- Chapter 622: Is this your attitude towards your savior?
- Chapter 621: Commander tearing mecha apart
- Chapter 620: Attack Commander
- Chapter 619: Attacked
- Chapter 618: Qin Xiaotian’s Secret Deal
- Chapter 617: Personal protection by the guards
- Chapter 616: Enemies meet on a narrow road
- Chapter 615: An acquaintance in a strange tavern
- Chapter 614: Star City
- Chapter 613: Luxurious Royal Guard Fleet
- Chapter 612: Zhao Chen’s decision
- Chapter 611: Hell’s Angels are coming!
- Chapter 610: Xue Xiaoxiao’s mission
- Chapter 609: Star Alliance
- Chapter 608: The right agent
- Chapter 607: Snatch food from the tiger’s mouth!
- Chapter 606: Big cat who loves fish
- Chapter 605: Golden Eden
- Chapter 604: Super Ship
- Chapter 603: Continue to expand
- Chapter 602: Commander’s Bloodline
- Chapter 601: Resurrection Medal
- Chapter 600: Xiaolong restricted area
- Chapter 599: Qin Xiaotian’s Secret
- Chapter 598: Coming to steal the job?
- Chapter 597: I have a request
- Chapter 596: Zhao Chen lost contact
- Chapter 595: Growing sister
- Chapter 594: All fear comes from insufficient firepower
- Chapter 593: The Second Xiaolong Corps, here we come!
- Chapter 592: Leviathan Monarch-class Hive Ship
- Chapter 591: This is the responsibility of the interstellar frigate
- Chapter 590: Storm Fortress Starport
- Chapter 589: Dragon Galaxy Defense War
- Chapter 588: Whoever dares to stop the production line will get out!
- Chapter 587: Hundred Thousand Insect Swarm
- Chapter 586: My brother is here
- Chapter 585: Iron Spider
- Chapter 584: Unexpected Enemies
- Chapter 583: Qin Xiaotian made a move
- Chapter 582: New Mission
- Chapter 581: Is Qin Ming dead?
- Chapter 580: Mission accomplished?
- Chapter 579: Deposed the Second Prince
- Chapter 578: Qin Ming’s world turned upside down
- Chapter 577: This is all my savings.
- Chapter 576: Qin Ming wants to become emperor
- Chapter 575: He’s not here!
- Chapter 574: The prey is coming
- Chapter 573: Wait for him to fall into the trap
- Chapter 572: Wash it clean and then sell it
- Chapter 571: This battle can’t be won
- Chapter 570: Beiyan and Xiaolong
- Chapter 569: Loyal Dog Plan, execute!
- Chapter 568: One hundred and twenty thousand? Where did they get those interstellar battleships?
- Chapter 567: The Imperial Princess Fleet, come on!
- Chapter 566: A carnival for His Royal Highness
- Chapter 565: All fleets are ready to jump.
- Chapter 564: Encirclement and annihilation of Chu Changhe
- Chapter 563: This is the burial place of the Chu family
- Chapter 562: The new year starts with accepting tasks!
- Chapter 561: Annie wants to quit!
- Chapter 560: I don’t want this sister anymore, whoever wants her can take her!
- Chapter 559: Super Black Technology
- Chapter 558: Year-end task gift pack
- Chapter 557: Advancement, Commander!
- Chapter 556: Zhao Chen’s Business Empire
- Chapter 555: Chu Changhe’s January Offensive
- Chapter 554: Cheers to our great hero, Annie!
- Chapter 553: Zhao Chen’s Gift
- Chapter 552: Super cheap T4 Star Destroyer
- Chapter 551: The debt collector is coming
- Chapter 550: The Imperial Senate is shaken
- Chapter 549: You wouldn’t... buy on credit, would you?
- Chapter 548: Paladin-class heavy interstellar missile frigate’s star shield matrix
- Chapter 547: Intercept them all!
- Chapter 546: What is the gap?
- Chapter 545: The Real Storm
- Chapter 544: You are the real winner
- Chapter 543: We admit defeat in this game
- Chapter 542: The first battle: Xiaolong wins!
- Chapter 541: The glory of the winner
- Chapter 540: This gun is too solid.
- Chapter 539: Throw it in his face!
- Chapter 538: Turn off the star shield and withstand the attack!
- Chapter 537: Blue-Eyes White Dragon PK Punishment Angel
- Chapter 536: Holy War Duel: Start
- Chapter 535: Three duels begin!
- Chapter 534: Captain Arrangement of Blue-Eyes White Dragon No.1
- Chapter 533: The silver-white star dragon!
- Chapter 532: Their interstellar battleships?
- Chapter 531: Attack of Annie!
- Chapter 530: I don’t even know how to write the word lose
- Chapter 529: Holy War Duel
- Chapter 528: Holy Spirit Man
- Chapter 527: The most powerful interstellar empire
- Chapter 526: This beef leg is so tender
- Chapter 525: It’s you! Blue-Eyes White Dragon!
- Chapter 524: Late quarterly tasks
- Chapter 523: Revenge of the Great White Cat
- Chapter 522: Imperial Civil War
- Chapter 521: The war has begun!
- Chapter 520: We’re taking over the galaxy
- Chapter 519: Parting Ways
- Chapter 518: The little white cat has grown up
- Chapter 517: Follow me
- Chapter 516: A bit of loss
- Chapter 515: Red Lightning’s Strangulation
- Chapter 514: The abandoned eagle
- Chapter 513: How could they have T4?
- Chapter 512: The other party has no martial ethics!
- Chapter 511: What is that eagle doing!
- Chapter 510: If you dare, beat me to death!
- Chapter 509: The Revolutionary Army’s Desperate Situation
- Chapter 508: The former queen
- Chapter 507: Medusa’s Request
- Chapter 506: Charlotte’s Dragon Tigers
- Chapter 505: Come back and I’ll teach you
- Chapter 504: The big white cat bit someone!
- Chapter 503: It depends on whether the teeth of the war hammer can bite!
- Chapter 502: Take care, Marshal!
- Chapter 501: Two major mining groups were established!
- Chapter 500: Not many, only about 20,000...
- Chapter 499: T4 class interstellar frigate
- Chapter 498: Even if there is no opportunity, we must create one and go for it!
- Chapter 497: Little Princess Bloody Seven Stars
- Chapter 496: The Royal Family’s Only Hope
- Chapter 495: The little princess is in my hands
- Chapter 494: What good will it do if I bring your grandfather back?
- Chapter 493: Starfleet disappears into thin air
- Chapter 492: Xue Xiaoxiao’s dream came true
- Chapter 491: These two people must die!
- Chapter 490: The sudden appearance of the Xiaolong Army
- Chapter 489: You don’t need to worry about how my old man will take care of himself.
- Chapter 488: Kick that shit throne over
- Chapter 487: Let’s go meet our father-in-law…
- Chapter 486: Chu family secret guard, greetings to the Marshal!
- Chapter 485: Execution of Chu Changhe
- Chapter 484: Chu Changhe Kills the Emperor
- Chapter 483: Treat our Marquis Beilang well
- Chapter 482: The Future Fortune of Marquis Beilang
- Chapter 481: Brother, avenge me!
- Chapter 480: Zhao Chen! I’ll be waiting for you down there!
- Chapter 479: Today, none of your interstellar battleships can leave
- Chapter 478: Want to surrender? Let Qin Hu tell me in person.
- Chapter 477: Wolverine Hunt
- Chapter 476: Heavy Interstellar Destroyer
- Chapter 475: The interstellar air battle between T3 Phoenix and T4 Star Emperor
- Chapter 474: The first T4 starship to fall
- Chapter 473: Look! Six billion is burning!
- Chapter 472: Three thousand T3-class interstellar battleships
- Chapter 471: Who told you that I only have these interstellar battleships?
- Chapter 470: The interstellar battlefield that everyone is paying attention to
- Chapter 469: The system killed you, don’t blame me
- Chapter 468: They only have 500 ships, and we have 20,000! How can we lose!
- Chapter 467: Anyone who trespasses into the Xiaolong system will die!
- Chapter 466: The sword is sharpened, ready to drink blood
- Chapter 465: I will be their token of surrender
- Chapter 464: You are now my hostage.
- Chapter 463: I really thought it was robbed by me
- Chapter 462: Let go, can’t you see that I don’t want to?
- Chapter 461: T4 Suzaku-class medium-sized interstellar cruiser unveiled!
- Chapter 460: Do they really dare to collide?
- Chapter 459: If it blocks the road, run over it.
- Chapter 458: Her Hero
- Chapter 457: Caged Bird
- Chapter 456: Let me see your brother’s big cannon!
- Chapter 455: Su Lan’s Gratitude
- Chapter 454: Prince Yan’s support
- Chapter 453: T4 Gemini-class heavy interstellar industrial ship
- Chapter 452: Annie said she wasn’t there
- Chapter 451: The third T4 interstellar battleship of the Star Empire!
- Chapter 450: Su Lan’s political marriage
- Chapter 449: How about we make a real play?
- Chapter 448: Zhao Chen is a scumbag who abandoned his wife and children
- Chapter 447: The prince’s party took the lead
- Chapter 446: The eldest sister urged me to get married
- Chapter 445: This sleep is like a dream...
- Chapter 444: Thirty ships? Is that enough?
- Chapter 443: Battleship
- Chapter 442: Annual mission accomplished!
- Chapter 441: I have created this God!
- Chapter 440: This is impossible!
- Chapter 439: This is just the beginning of revenge
- Chapter 438: A real T4 starship
- Chapter 437: Defend the main star!
- Chapter 436: What kind of interstellar frigate is this?
- Chapter 435: Like ramming ships?
- Chapter 434: Stealth warship of unknown origin
- Chapter 433: Wolf King Star Port Fortress
- Chapter 432: Dare to bully my little tiger
- Chapter 431: Seeds buried in Warhammer
- Chapter 430: Sister Charlotte has gained weight
- Chapter 429: A massacre of four hundred against three thousand!
- Chapter 428: Look at the meteor shower
- Chapter 427: I, Charlotte, am back!
- Chapter 426: A month? It won’t take that long.
- Chapter 425: The situation of the White Tiger tribe
- Chapter 424: This is my commander.
- Chapter 423: Rice bag?
- Chapter 422: Big gold mine!
- Chapter 421: The pawn of the prince’s party
- Chapter 420: I, Zhao Chen, want these two galaxies.
- Chapter 419: The Xu family’s situation
- Chapter 418: Military Starport
- Chapter 417: The first "battle damage"
- Chapter 416: The first ship of the T4 Suzaku-class medium-sized interstellar cruiser was launched on trial
- Chapter 415: New flagship! T4!
- Chapter 414: Recruitment plan
- Chapter 413: The Xiaolong Lord is a breakthrough
- Chapter 412: Massive military expansion
- Chapter 411: Workaholic Annie!
- Chapter 410: Why do I hear the sound of an abacus?
- Chapter 409: The little princess’s treasury
- Chapter 408: I have money
- Chapter 407: How many secrets do you have?
- Chapter 406: How about we support the little princess?
- Chapter 405: Zhao Ruyue’s ideological subversion
- Chapter 404: Hot Potato
- Chapter 403: The Lost Starfleet
- Chapter 402: Bite them for me!
- Chapter 401: An unexpected lifesaver
- Chapter 400: I’m here to take the young lady home.
- Chapter 399: Is it true that we can never go back to the Xiaolong galaxy?
- Chapter 398: The Destroyed Royal Fleet
- Chapter 397: The little princess is not of royal blood!
- Chapter 396: The consecration ceremony begins
- Chapter 395: The Second Prince and Prince Yan
- Chapter 394: If you go against it, you will fail.
- Chapter 393: Star Empire·Imperial Star
- Chapter 392: You call this a bowl of noodles?
- Chapter 391: Congratulations on getting a T4 star battleship!
- Chapter 390: Expanding the interstellar missile ship? She might as well sell me out.
- Chapter 389: Completely wiped out? How is that possible!
- Chapter 388: Capture your Black Wolf Princess and make her my commander’s maid
- Chapter 387: Old acquaintance
- Chapter 386: Who defeated me?
- Chapter 385: Xiaolong Bulldozer
- Chapter 384: The interstellar frigate still wants to shit on my head?
- Chapter 383: I’ll take these ten thousand interstellar battleships!
- Chapter 382: Sudden ambush
- Chapter 381: Intercept and block the Warhammer Star Fleet!
- Chapter 380: Zhao Chen’s mysterious strategy
- Chapter 379: Emperor Xingyao summoned and conferred the title
- Chapter 378: The Shock of the Star Empire
- Chapter 377: The eldest prince was attacked and killed
- Chapter 376: Shocking news from the Star Empire!
- Chapter 375: The Secret Reborn
- Chapter 374: Guan Tongtong’s ’Heavenly Life’
- Chapter 373: This money-burning movement is a bit big
- Chapter 372: Strength is gained through fighting
- Chapter 371: First casualty list
- Chapter 370: T3 Triceratops-class interstellar heavy assault frigate ramming ship
- Chapter 369: The indestructibility of the T3 Emperor-class heavy interstellar battleship
- Chapter 368: Ten minutes! Billions of dollars were thrown away
- Chapter 367: Ten Minutes of Destruction
- Chapter 366: The first battle of the T3 Inquisitor-class heavy interstellar missile ship
- Chapter 365: The target is within range
- Chapter 364: How can three hundred interstellar battleships turn the tide of the war?
- Chapter 363: That man, here he comes
- Chapter 362: The two factions united to kill the snake people
- Chapter 361: I am your only lifeline.
- Chapter 360: Reversal of interstellar battlefield
- Chapter 359: The Snakeman’s Super Battleship
- Chapter 358: Queen Medusa’s ’Dagger’
- Chapter 357: Live broadcast of the first battle on the reef
- Chapter 356: Anne’s ’Vacation’
- Chapter 355: Chief Engineer Annie who cannot be contacted
- Chapter 354: Three thousand interstellar battleships
- Chapter 353: Impossible! Beiyan cannot deliver the order
- Chapter 352: Beiyan’s military procurement orders
- Chapter 351: T4 Starship completed
- Chapter 350: The Battle of the Three Powers in the Reef Star Region
- Chapter 349: Mission: Battle for the Reef
- Chapter 348: Situation in the Reef Sector
- Chapter 347: The Queen is going to buy a ship
- Chapter 346: Separation of the Family
- Chapter 345: The dramatic changes of the Li family
- Chapter 344: The Northern Goose Rebellion
- Chapter 343: Is the military procurement order going to be breached?
- Chapter 342: Something happened to Beiyan
- Chapter 341: Food bill comes into effect
- Chapter 340: The Lords’ Act, true or false?
- Chapter 339: Anne’s Small Business
- Chapter 338: Xiaolong Army
- Chapter 337: Anne’s Commendation Ceremony
- Chapter 336: The storm vortex of interest distribution
- Chapter 335: The romance of big ships and big guns
- Chapter 334: Silver Eden
- Chapter 333: Weird T3 interstellar missile ship
- Chapter 332: Orbital bombardment of Zerg planet
- Chapter 331: Battle of Morton Stargate - End
- Chapter 330: We will pave the way for you to attack
- Chapter 329: Carrying out the final combat mission, the machine was ordered to self-destruct
- Chapter 328: There’s no turning back now.
- Chapter 327: Roaring North Wind
- Chapter 326: Strong Fire Dragon
- Chapter 325: Target: T4 Hive Mothership
- Chapter 324: Chu Family Fleet: God of the North Wind
- Chapter 323: Unexpected reinforcements
- Chapter 322: Mobile ’War Fortress’
- Chapter 321: A true interstellar monster
- Chapter 320: T4 Leviathan-class Hive Carrier
- Chapter 319: Hunter-class Leviathan
- Chapter 318: The Battle of Moulton officially begins
- Chapter 317: Level 4 cosmic wormhole
- Chapter 316: Weird mission
- Chapter 315: Nanny Starship·In Place
- Chapter 314: Impeach Zhao Chen?
- Chapter 313: Massacre
- Chapter 312: First Battle against the Zerg
- Chapter 311: You choose your own path
- Chapter 310: Meeting an old friend in a foreign land
- Chapter 309: Because it’s so ugly
- Chapter 308: If you don’t believe it, you can try it.
- Chapter 307: It’s all your fault! Otherwise I would be his brother-in-law
- Chapter 306: My sister is the fiancée of Lord Xiaolong
- Chapter 305: I need more starships.
- Chapter 304: They are both lords, why is there such a big difference?
- Chapter 303: For the overall situation
- Chapter 302: The Crisis of the Chiang Family
- Chapter 300: Hundreds of cosmic wormholes
- Chapter 299: The Insect Plague in the North Wind Star Region
- Chapter 298: Issue a Lord’s Decree
- Chapter 297: A new look for Charlotte
- Chapter 296: You must be tired outside.
- Chapter 295: How about I build you another galaxy?
- Chapter 294: A grandfather’s advice
- Chapter 293: Anne’s Side Job
- Chapter 292: Pink memories
- Chapter 291: Annual tasks with rich rewards
- Chapter 290: Huge fireworks
- Chapter 289: Today’s harvest, three ships
- Chapter 288: T4 interstellar jump ship
- Chapter 287: Mission accomplished, new love
- Chapter 286: Three prisoners
- Chapter 285: Red eyes under the mask
- Chapter 284: Don’t worry, you’ll soon find out who we are.
- Chapter 283: People are more important than fighter planes
- Chapter 282: Our candy is very popular.
- Chapter 281: Time for revenge
- Chapter 280: Terrifying long-range attack capability I
- Chapter 279: T3 aircraft carrier starship?
- Chapter 278: The system task of making trouble
- Chapter 277: Revenge is the fine tradition of our Xiaolong Fleet.
- Chapter 276: Zhao Chen’s new flagship
- Chapter 275: Red Starship
- Chapter 274: Commander, I don’t want to expose your little tricks.
- Chapter 273: Countdown to Revenge
- Chapter 272: Military purchase order of 45 billion star coins
- Chapter 271: T2 Tibetan Mastiff wins military purchase order
- Chapter 270: T2 Tibetan Mastiff·Crown as King
- Chapter 269: The best T2 star destroyer showdown
- Chapter 268: I question the data falsification of this T2 Tibetan Mastiff
- Chapter 267: Incredible offer
- Chapter 266: The starship that crushes in all directions
- Chapter 265: Friendly business? Just give me your ID card.
- Chapter 264: Su Lan’s Melancholy
- Chapter 263: Little Princess of the Empire
- Chapter 262: Governor of the North Wind
- Chapter 261: The confidence of the Feng family father and son
- Chapter 260: Let me see how high you can go
- Chapter 259: Come, call sister-in-law
- Chapter 258: Prepare to fully equip T3 interstellar battleships
- Chapter 257: Phoenix-class heavy aircraft carrier starship
- Chapter 256: Seasonal Mission: T3 Starship
- Chapter 255: The connection between the two star gates
- Chapter 254: Are you going to deny it?
- Chapter 253: We must avenge this
- Chapter 252: I can help you get revenge
- Chapter 251: Bloody Mary Survivor
- Chapter 250: Burning interstellar space station
- Chapter 249: Trigger hidden mission Recruitment
- Chapter 248: Traitor in the Mercenary Group
- Chapter 247: Lion King or Sick Cat?
- Chapter 246: Battle between interstellar battlecruisers
- Chapter 245: Who can come to save you in this place?
- Chapter 244: Please save Chi Tong
- Chapter 243: Interstellar Academy in the Crystal Ball
- Chapter 242: Xiaolong Resource Star Zone
- Chapter 241: Huiyue-class Stargate No. 1: Activated
- Chapter 240: Annie, this is fat.
- Chapter 239: War is always the best way to get rich
- Chapter 238: Your Majesty, would you consider an interstellar missile ship?
- Chapter 237: Such a horrific record
- Chapter 236: Burning Salamander Starport
- Chapter 235: Bombard the Salamanders’ Base Camp Starport
- Chapter 234: Always reciprocate
- Chapter 233: Your T2 interstellar battleship is hacked.
- Chapter 232: The ’overconfident’ T2 Snow Mastiff-class heavy interstellar battleship
- Chapter 231: It’s not that we are incompetent, it’s just that the enemy ships are too strong
- Chapter 230: Interstellar Battleship Dancing with Death
- Chapter 229: And two interstellar missile ships?
- Chapter 228: Little Axe is about to start racing
- Chapter 227: Ride on the face and output, and walk away
- Chapter 226: There’s something wrong with this T3 starship’s shield
- Chapter 225: T3 Phantom Thorn-class Light Interstellar Stealth Bomber Hunting Time
- Chapter 224: Kill me? You are worthy
- Chapter 223: Two ’old friends’
- Chapter 222: Queen Medusa
- Chapter 221: Snake Queen
- Chapter 220: Three thousand starships, swords pointed at the Lion King
- Chapter 219: Head to the Lion Galaxy and fight the Salamanders again
- Chapter 218: The amazing technology of T4 starship
- Chapter 217: Official graduation
- Chapter 216: No one else cares, I, Zhao Chen, will.
- Chapter 215: Fairies can fulfill wishes
- Chapter 214: Starships that only smart people can see
- Chapter 213: Interstellar Mining Ship
- Chapter 212: If you have a T3 aircraft carrier starship, I can consider it.
- Chapter 211: This is the medal I earned with my love’s life.
- Chapter 210: Empire Veteran
- Chapter 209: An old acquaintance in the Reef Star Region
- Chapter 208: Benefits of the Xiaolong Fleet
- Chapter 207: Dwarf City
- Chapter 206: Isn’t it radiant to see you?
- Chapter 205: Ghost Face Girl Red Eyes
- Chapter 204: The Empire’s military procurement orders
- Chapter 203: T3 Huiyue Star Gate
- Chapter 202: Our own star gate
- Chapter 201: From now on it’s called the Lion Galaxy
- Chapter 200: Tell them who is the master of this galaxy now
- Chapter 199: Comparing ships to each other is infuriating
- Chapter 198: I’m going to fuck your flagship right in front of you.
- Chapter 197: T2 Lions’ debut
- Chapter 196: The lands hit by the bombardment were all ruins.
- Chapter 195: Wolf Girl Snow White
- Chapter 194: Xiaolong Fleet
- Chapter 193: Salamander Chief’s Declaration of War
- Chapter 192: Annie has a job and can support you.
- Chapter 191: Congratulations on getting the first batch of dwarf craftsmen
- Chapter 190: Capture the Galaxy
- Chapter 189: Ambassador Anne
- Chapter 188: Burning T3 Arkham-class medium-sized starship
- Chapter 187: Fire strike! Target: enemy fleet flagship
- Chapter 186: T3 Blizzard VST3 Arkham
- Chapter 185: Except for T3, they are all scrap metal
- Chapter 184: The commander is a big liar
- Chapter 183: An interstellar cruiser of unknown origin?
- Chapter 182: The Dwarfs’ Despair
- Chapter 181: Salamanders targeting dwarves
- Chapter 180: Reef
- Chapter 179: The underage hibernation capsule came out to work
- Chapter 178: Charlotte
- Chapter 177: Pulling the T2 Hyena off its sales pedestal
- Chapter 176: T2 Tibetan Mastiff-class medium star destroyer
- Chapter 175: Poking their wallets
- Chapter 174: Senior Zhao Chen
- Chapter 173: Returning to the academy, treated like a hero
- Chapter 172: Anne wants a pay raise
- Chapter 171: Oops! We are short of talent.
- Chapter 170: Anne loves working the most.
- Chapter 169: Bull Head Girl’s Embrace
- Chapter 168: Make a fake thing come true
- Chapter 167: How come this old man looks so handsome?
- Chapter 166: When will I have a sister-in-law?
- Chapter 165: The Mystery of the Big Sister
- Chapter 164: Viscount of the Empire
- Chapter 163: Rewarding crystal? Could it be him?
- Chapter 162: Princess’s personal fleet, arrive
- Chapter 161: Dare to touch my precious grandson-in-law, I will destroy his doghouse
- Chapter 160: I’m here to take our grandson-in-law home.
- Chapter 159: If I say no, what can you do to me?
- Chapter 158: Zhao Chen’s confidante
- Chapter 157: The three big guys from the Blue Star Region gathered together
- Chapter 156: Azure Governor
- Chapter 156: Azure Governor
- Chapter 155: But I, Zhao Chen, am not afraid
- Chapter 154: Narrow your own path
- Chapter 153: I can build you a T4 starship
- Chapter 152: Governor of Chuhe
- Chapter 151: Interstellar stealth bomber?
- Chapter 150: Check this Zhao Chen for me
- Chapter 149: Believe it or not, I will spend a T3 starship to kill you
- Chapter 148: You order, we don’t charge a penny
- Chapter 147: ’Swindler’ Zhao Chen
- Chapter 146: You stink.
- Chapter 145: Is this white tiger pure?
- Chapter 144: What did you say? I didn’t hear you clearly.
- Chapter 143: What are you doing on my starship?
- Chapter 142: Launch an academy ship?
- Chapter 141: Swarm Breakout
- Chapter 140: Sea of Insects
- Chapter 139: The future beauty
- Chapter 138: Just the saliva of two insects
- Chapter 137: Blizzard’s bow gun
- Chapter 136: T3 Blizzard’s First Star War
- Chapter 135: T3 Hive Mothership
- Chapter 134: Hand-tear mecha
- Chapter 133: Thunder Beast Attack
- Chapter 132: I thought... I was going to die...
- Chapter 131: How could you not invite me to such an exciting party?
- Chapter 130: If you can’t break it, just jump for me
- Chapter 129: T3 interstellar battleship enters the atmosphere
- Chapter 128: Snowstorm Extreme Cruise Mode
- Chapter 127: Choose the shortest one between two points!
- Chapter 126: No one will come to rescue us.
- Chapter 125: Target! The Swarm
- Chapter 124: It’s called a blizzard
- Chapter 123: If you don’t save me, I will save you myself.
- Chapter 122: Zhao Waner encounters crisis
- Chapter 121: T3 Super Soldier Potion
- Chapter 120: The first T3 interstellar battleship was launched
- Chapter 119: Promotion to fifth grade
- Chapter 118: Are you willing to cooperate with our Chu family?
- Chapter 117: The eldest lady of the Chu family
- Chapter 116: The perfect ecosystem on the starship
- Chapter 115: T2 Bronze Eden-class starship
- Chapter 114: The Old Man of the Chu Family
- Chapter 113: Ten times the reward
- Chapter 112: Need to pay extra
- Chapter 111: Reception of a Brigadier General
- Chapter 110: We need an explanation
- Chapter 109: Something Wrong with the Escort Mission
- Chapter 108: Galactic Alliance Prohibition
- Chapter 107: T2 Lion King class heavy interstellar missile ship
- Chapter 106: A Starship Missile Ship
- Chapter 105: T2 starship vs. T3 starship
- Chapter 104: Mechanical T3 starship
- Chapter 103: How can a T2 starship have a star shield?
- Chapter 102: Starship also plays dismemberment?
- Chapter 101: Aircraft carrier starship as bait
- Chapter 100: Warp Jammer
- Chapter 99: Escort mission: Departure
- Chapter 98: Annie...can you...eat this?
- Chapter 97: Anne the Dwarf
- Chapter 96: Interstellar Craftsmen - Dwarves
- Chapter 95: Galactic Alliance and the Machines
- Chapter 94: Imperial Flagship - God of the North Wind
- Chapter 93: Northern Galaxy 3
- Chapter 92: Military escort mission
- Chapter 91: Four Starship Technologies
- Chapter 90: Li Yaqi’s Business Legend
- Chapter 89: One sells his sister, the other sells his schoolmate
- Chapter 88: Small ship hits big ship
- Chapter 87: It’s just a tough interstellar frigate.
- Chapter 86: It’s actually an interstellar frigate?
- Chapter 85: Triple Assessment Credits
- Chapter 84: Then let’s play a game
- Chapter 83: Are you crying?
- Chapter 82: The best-selling T1 starship
- Chapter 81: Annual and quarterly tasks
- Chapter 80: Stars and bright moon, swear to follow you till death
- Chapter 79: Promoted to Fleet Commander
- Chapter 78: The apple of the eye of two imperial dukes
- Chapter 77: I don’t have time. I’m busy building a starship.
- Chapter 76: Chu Xuan, a prominent figure
- Chapter 75: Golden Emblem: Chu
- Chapter 74: Preparing to build the third interstellar battleship
- Chapter 73: The mysterious origin of the Black Dragon Fleet
- Chapter 72: A mini version of the armored behemoth?
- Chapter 71: I’m afraid this person is obsessed with money.
- Chapter 70: The triumphant return of Blizzard Zero
- Chapter 69: Is this going to hit the ship?
- Chapter 68: Speed up and hit me
- Chapter 67: White Tiger General Charlotte
- Chapter 66: Insect Swarm Tactics
- Chapter 65: Just two starships?
- Chapter 64: Hive Ship
- Chapter 63: They really dare to fire
- Chapter 62: Target! Arctic Fox Galaxy Edge·P331 Asteroid
- Chapter 61: Interstellar Zerg
- Chapter 60: T2 Hammer-class heavy interstellar industrial ship
- Chapter 59: Xiaolong Fleet
- Chapter 58: They could have endured the darkness, as long as they had never seen the light.
- Chapter 57: Succubus’s Cry
- Chapter 56: Wherever you want to go, I can take you there.
- Chapter 55: The succubi who are full of food
- Chapter 54: This is not a starship, this is clearly heaven
- Chapter 53: Succubus Lilith
- Chapter 52: Interstellar Succubus
- Chapter 51: Female soldiers’ uniforms
- Chapter 50: I want to achieve ’food freedom’
- Chapter 49: Building a new city on the ruins
- Chapter 48: Zhao Chen’s Death List
- Chapter 47: Butcher Zhao Chen
- Chapter 46: If the living can’t come, the dead will do.
- Chapter 45: I, Zhao Chen, am back
- Chapter 44: From the moment they stepped into this place, surrender was not an option.
- Chapter 43: We surrender
- Chapter 42: Does this T2 aircraft carrier starship have a star shield?
- Chapter 41: One shot kill · T2 heavy star destroyer
- Chapter 40: The first battle of the T2 Queen Bee-class heavy aircraft carrier starship
- Chapter 39: The game begins, Lord Baron
- Chapter 38: The Storm in the Xiaolong Galaxy
- Chapter 37: Go to Xiaolong System
- Chapter 36: Interstellar Industrial Ship
- Chapter 35: T2 Queen Bee-class heavy aircraft carrier starship completed
- Chapter 34: I took away my eldest sister’s wish
- Chapter 33: I want to build a ship
- Chapter 32: Stargate Jump Arctic Fox Starport
- Chapter 31: Blizzard Zero’s first warp trip
- Chapter 30: Something happened to the Xiaolong Galaxy
- Chapter 29: I want a fleet of hope! Not the walking dead!
- Chapter 28: We can have rice for every meal...
- Chapter 27: He even packed
- Chapter 26: You can sell that T2 Bald Eagle.
- Chapter 25: Just kneel down.
- Chapter 24: Brother Zhaochen, can I see your cannon?
- Chapter 23: Three million star coins, buyout
- Chapter 22: Mysterious Starship Technology
- Chapter 21: Zhao Chen’s T2 super aircraft carrier starship
- Chapter 20: It’s you! Aircraft carrier starship
- Chapter 19: Selling Starship Technology
- Chapter 18: Zhao Chen won?
- Chapter 17: A single shot sealed the victory
- Chapter 16: fire
- Chapter 15: Show us our 1200mm cannon! Fuck him!
- Chapter 14: The Ten-Minute Battle of the White-Haired Beast-Eared Girl
- Chapter 13: The showdown begins! Bald Eagle vs. Blizzard Zero
- Chapter 12: Zhang Haoran’s Starship T2 Bald Eagle Class Light Interstellar Cruiser
- Chapter 11: You don’t believe me? Then I will win for you.
- Chapter 10: First test voyage of the Blizzard Zero
- Chapter 9: Vice Captain: Beast Girl Charlotte
- Chapter 8: I got a white-haired half-beast girl
- Chapter 7: The first starship: Storm Zero
- Chapter 6: Assembling the starship
- Chapter 5: Exchange for three broken starships? This guy must be crazy
- Chapter 4: Starship Duel
- Chapter 3: The Waste Baron’s Fiancee
- Chapter 2: A starfleet that can only recruit female soldiers?
- Chapter 1: The system is messing up
Comments